Scaffold Ga0136855_166751

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136855_166751

Scaffold Ga0136855_166751

Overview

Basic Information
Taxon OID	3300010409 Open in IMG/M
Scaffold ID	Ga0136855_166751 Open in IMG/M
Source Dataset Name	Giant kelp blades associated microbial communities from the kelp forest near Monterey Bay Aquarium, California, USA ? sample B
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Leibniz Institute
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1172
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Brown Algae → Unclassified → Unclassified → Marine Brown Algae (Kelp) Associated → Giant Kelp Blades Associated Microbial Communities From The Kelp Forest Near Monterey Bay Aquarium, California, Usa

Source Dataset Sampling Location
Location Name	Monterey Bay, California, USA
Coordinates	Lat. (^o)	36.619	Long. (^o)	-121.9	Alt. (m)		Depth (m)	6
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077438	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136855_1667512	F077438	N/A	STHRVERPFAQSRFETLFLWSLQVEISSDLMPTVEKEISSNKN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.