NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0139308_126202

Scaffold Ga0139308_126202


Overview

Basic Information
Taxon OID3300010996 Open in IMG/M
Scaffold IDGa0139308_126202 Open in IMG/M
Source Dataset NameELM11109_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)867
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment → Cwc Coastal Marshes

Source Dataset Sampling Location
Location NameLouisiana, Port Sulphur, Bay Sansbois east
CoordinatesLat. (o)29.4542Long. (o)-89.76993Alt. (m)Depth (m)0 to .02
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F088437Metagenome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0139308_1262021F088437N/ACVGESGSGCHFSYIVVGLGTMAWTTIACPIELALGVEPPTHIIEDEKHMKECSEKVYVPIVYAPKEALIWWIDYIDSVSEGALLSSLERFKAISERLAHIVGANVDGWDPAQQALQKAFPGITLTECHLHAMIKFGQHLATFKRQRKAMGQSVSEQEEAQIRAAFARVLQAPTPAAYQKALNDLPNVFDNEPLVSRKDSLVTKQALFQAWTTDAKLAVVSTPLDQCMKFLNRKQDNMQTLHGPKSGLATVNAWAITRNCWRFLKGALRAGLSPLELAGANFLGIPWMQL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.