Scaffold Ga0151664_1009827

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0151664_1009827

Scaffold Ga0151664_1009827

Overview

Basic Information
Taxon OID	3300011256 Open in IMG/M
Scaffold ID	Ga0151664_1009827 Open in IMG/M
Source Dataset Name	Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, total
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Toyama Prefectural University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	9840
Total Scaffold Genes	14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	7 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Sediment → Marine → Environmental Dna From Seawater And Marine Sediment

Source Dataset Sampling Location
Location Name	Japan Sea near Toyama Prefecture, JAPAN
Coordinates	Lat. (^o)	37.36023	Long. (^o)	137.9591	Alt. (m)		Depth (m)	570
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025141	Metagenome / Metatranscriptome	203	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0151664_10098278	F025141	N/A	MIQCEYCPRGFIETVNGLAEKTFHELLHEPDVVNK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.