NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F025141

Metagenome / Metatranscriptome Family F025141

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F025141
Family Type Metagenome / Metatranscriptome
Number of Sequences 203
Average Sequence Length 36 residues
Representative Sequence MIQCEYCPRGFIETANGLAEKTFHELLHEPEVVNK
Number of Associated Samples 170
Number of Associated Scaffolds 203

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Archaea
% of genes with valid RBS motifs 0.00 %
% of genes near scaffold ends (potentially truncated) 40.89 %
% of genes from short scaffolds (< 2000 bps) 74.88 %
Associated GOLD sequencing projects 165
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (89.655 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine
(12.808 % of family members)
Environment Ontology (ENVO) Unclassified
(50.739 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(59.113 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 25.40%    β-sheet: 6.35%    Coil/Unstructured: 68.25%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 203 Family Scaffolds
PF00999Na_H_Exchanger 13.30
PF13641Glyco_tranf_2_3 3.94
PF00252Ribosomal_L16 1.97
PF02778tRNA_int_endo_N 1.48
PF00581Rhodanese 0.99
PF13187Fer4_9 0.99
PF12838Fer4_7 0.99
PF03167UDG 0.49
PF10559Plug_translocon 0.49
PF14947HTH_45 0.49
PF13307Helicase_C_2 0.49
PF01061ABC2_membrane 0.49
PF13632Glyco_trans_2_3 0.49
PF12840HTH_20 0.49
PF00572Ribosomal_L13 0.49
PF08734GYD 0.49
PF13685Fe-ADH_2 0.49
PF04402SIMPL 0.49
PF01513NAD_kinase 0.49

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 203 Family Scaffolds
COG0025NhaP-type Na+/H+ or K+/H+ antiporterInorganic ion transport and metabolism [P] 13.30
COG0475Kef-type K+ transport system, membrane component KefBInorganic ion transport and metabolism [P] 13.30
COG3004Na+/H+ antiporter NhaAEnergy production and conversion [C] 13.30
COG3263NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domainsEnergy production and conversion [C] 13.30
COG4651Predicted Kef-type K+ transport protein, K+/H+ antiporter domainInorganic ion transport and metabolism [P] 13.30
COG0197Ribosomal protein L16/L10AETranslation, ribosomal structure and biogenesis [J] 1.97
COG1676tRNA splicing endonuclease subunit SEN34Translation, ribosomal structure and biogenesis [J] 1.48
COG0102Ribosomal protein L13Translation, ribosomal structure and biogenesis [J] 0.49
COG0692Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.49
COG1573Uracil-DNA glycosylaseReplication, recombination and repair [L] 0.49
COG2859Outer membrane channel-forming protein BP26/OMP28, SIMPL familyCell wall/membrane/envelope biogenesis [M] 0.49
COG2968Uncharacterized conserved protein YggE, contains kinase-interacting SIMPL domainFunction unknown [S] 0.49
COG3471Predicted secreted (periplasmic) proteinFunction unknown [S] 0.49
COG3663G:T/U-mismatch repair DNA glycosylaseReplication, recombination and repair [L] 0.49
COG4274Uncharacterized conserved protein, contains GYD domainFunction unknown [S] 0.49


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.66 %
UnclassifiedrootN/A10.34 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2061766003|GB_4MN_MetaGALL_nosff_rep_c91493All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus1550Open in IMG/M
2088090013|LWAnNN_GHFF8UE02JMLSAAll Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota506Open in IMG/M
2236876008|none_p543167Not Available503Open in IMG/M
2236876009|none_p085654All Organisms → cellular organisms → Archaea516Open in IMG/M
2263196002|LD2009400mD_c02782All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota1291Open in IMG/M
3300000117|DelMOWin2010_c10065278All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota1499Open in IMG/M
3300000136|KGI_S1_ANT02_95mDRAFT_c10038404All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota1556Open in IMG/M
3300000141|LPjun08P41300mDRAFT_c1007480All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota2056Open in IMG/M
3300000141|LPjun08P41300mDRAFT_c1045753All Organisms → cellular organisms → Archaea557Open in IMG/M
3300000142|LPaug09P16500mDRAFT_c1040896All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota690Open in IMG/M
3300000142|LPaug09P16500mDRAFT_c1066495All Organisms → cellular organisms → Archaea504Open in IMG/M
3300000143|SI53jan11_10mDRAFT_c101263All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota1349Open in IMG/M
3300000152|LPjun08P12500mDRAFT_c1043448All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota632Open in IMG/M
3300000155|SI36aug09_200mDRAFT_c1013720All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota744Open in IMG/M
3300000157|LPaug08P261000mDRAFT_c1048246All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota537Open in IMG/M
3300000164|SI39no09_200mDRAFT_c1051752All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota747Open in IMG/M
3300000170|SI36aug09_135mDRAFT_c1029413All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota876Open in IMG/M
3300000179|LPjun09P16500mDRAFT_c1048379All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota554Open in IMG/M
3300000186|LPfeb10P162000mDRAFT_c1004360All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota1079Open in IMG/M
3300000222|LPjun09P12500mDRAFT_1024166All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota1167Open in IMG/M
3300000222|LPjun09P12500mDRAFT_1072456All Organisms → cellular organisms → Archaea532Open in IMG/M
3300000238|SI36aug09_100mDRAFT_1044867All Organisms → cellular organisms → Archaea505Open in IMG/M
3300000254|SI34jun09_100mDRAFT_1002383All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus6746Open in IMG/M
3300000256|LP_F_10_SI03_120DRAFT_1017701All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus1738Open in IMG/M
3300000259|LP_J_08_P26_500DRAFT_1006548All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota1953Open in IMG/M
3300000323|LPaug09P202000mDRAFT_1017239All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota1196Open in IMG/M
3300000574|JGI1357J11328_10000232All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosarchaeum49059Open in IMG/M
3300000950|JGI11881J13070_1004065All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota1396Open in IMG/M
3300001073|C687J13245_100092All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae3732Open in IMG/M
3300001133|C687J13250_100354All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota1871Open in IMG/M
3300001380|JGI1356J14229_10164012All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota678Open in IMG/M
3300001683|GBIDBA_10060735All Organisms → cellular organisms → Archaea1893Open in IMG/M
3300001771|Beebe_1051069All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae532Open in IMG/M
3300001959|GOS2247_1066119All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus1540Open in IMG/M
3300001968|GOS2236_1003289All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae1806Open in IMG/M
3300002036|BIB32012_10117513All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae886Open in IMG/M
3300002036|BIB32012_10135970All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae801Open in IMG/M
3300002231|KVRMV2_100121374All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus salaria3906Open in IMG/M
3300002231|KVRMV2_101927479All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus534Open in IMG/M
3300002965|JGI26063J44948_1052903All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.775Open in IMG/M
3300003153|Ga0052192_1001033All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus1550Open in IMG/M
3300004150|Ga0055520_10166088All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.542Open in IMG/M
3300004213|Ga0066648_10660688All Organisms → cellular organisms → Archaea586Open in IMG/M
3300004278|Ga0066609_10057446All Organisms → cellular organisms → Archaea1323Open in IMG/M
3300005427|Ga0066851_10066126All Organisms → cellular organisms → Archaea1205Open in IMG/M
3300005589|Ga0070729_10414785All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.745Open in IMG/M
3300005590|Ga0070727_10026683All Organisms → cellular organisms → Archaea3706Open in IMG/M
3300005592|Ga0066838_10102033All Organisms → cellular organisms → Archaea811Open in IMG/M
3300005593|Ga0066837_10000839All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus14320Open in IMG/M
3300005593|Ga0066837_10103903All Organisms → cellular organisms → Archaea → TACK group1045Open in IMG/M
3300005600|Ga0070726_10178744All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus1087Open in IMG/M
3300005601|Ga0070722_10005885All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis3454Open in IMG/M
3300005601|Ga0070722_10020719All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus2110Open in IMG/M
3300005825|Ga0074476_1395590All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.887Open in IMG/M
3300005828|Ga0074475_10975199All Organisms → cellular organisms → Archaea1630Open in IMG/M
3300005829|Ga0074479_10090402All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus koreensis9382Open in IMG/M
3300005829|Ga0074479_10767911All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis → Candidatus Nitrosotenuis chungbukensis37839Open in IMG/M
3300005945|Ga0066381_10156508Not Available652Open in IMG/M
3300005945|Ga0066381_10195844Not Available580Open in IMG/M
3300005951|Ga0066379_10003735All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota3694Open in IMG/M
3300005951|Ga0066379_10143323All Organisms → cellular organisms → Archaea760Open in IMG/M
3300005951|Ga0066379_10276339All Organisms → cellular organisms → Archaea547Open in IMG/M
3300006019|Ga0066375_10050975All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus1388Open in IMG/M
3300006027|Ga0075462_10238847All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.540Open in IMG/M
3300006166|Ga0066836_10031427All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis2987Open in IMG/M
3300006308|Ga0068470_1283252All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis → Candidatus Nitrosotenuis cloacae3641Open in IMG/M
3300006308|Ga0068470_1408687Not Available815Open in IMG/M
3300006308|Ga0068470_1726711All Organisms → cellular organisms → Archaea512Open in IMG/M
3300006310|Ga0068471_1110725All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota9611Open in IMG/M
3300006310|Ga0068471_1127254All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis3353Open in IMG/M
3300006310|Ga0068471_1537023Not Available1734Open in IMG/M
3300006313|Ga0068472_10416396Not Available730Open in IMG/M
3300006313|Ga0068472_10416397All Organisms → cellular organisms → Archaea557Open in IMG/M
3300006313|Ga0068472_10507831Not Available926Open in IMG/M
3300006313|Ga0068472_10739426Not Available593Open in IMG/M
3300006315|Ga0068487_1025297All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis2500Open in IMG/M
3300006316|Ga0068473_1730563All Organisms → cellular organisms → Archaea828Open in IMG/M
3300006316|Ga0068473_1736440All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota625Open in IMG/M
3300006325|Ga0068501_1324878Not Available643Open in IMG/M
3300006339|Ga0068481_1428121All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota2140Open in IMG/M
3300006341|Ga0068493_10469900Not Available804Open in IMG/M
3300006346|Ga0099696_1114956Not Available875Open in IMG/M
3300006414|Ga0099957_1078389All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota1627Open in IMG/M
3300006414|Ga0099957_1108994All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis5296Open in IMG/M
3300006414|Ga0099957_1285499Not Available1158Open in IMG/M
3300006421|Ga0082247_10000024All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus koreensis9330Open in IMG/M
3300006421|Ga0082247_10283850All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon532Open in IMG/M
3300006466|Ga0082249_10664789All Organisms → cellular organisms → Archaea506Open in IMG/M
3300006567|Ga0099958_1112613All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae1973Open in IMG/M
3300006567|Ga0099958_1250926Not Available1348Open in IMG/M
3300006643|Ga0101445_100304All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus koreensis2663Open in IMG/M
3300006872|Ga0101947_1006771All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis → Candidatus Nitrosotenuis cloacae6874Open in IMG/M
3300006902|Ga0066372_10950265Not Available524Open in IMG/M
3300006958|Ga0101660_100145All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis3684Open in IMG/M
3300007283|Ga0066366_10370383All Organisms → cellular organisms → Archaea618Open in IMG/M
3300007291|Ga0066367_1051458All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → unclassified Thaumarchaeota → Thaumarchaeota archaeon1456Open in IMG/M
3300007760|Ga0105018_1050980All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota1677Open in IMG/M
3300007778|Ga0102954_1279388All Organisms → cellular organisms → Archaea507Open in IMG/M
3300008223|Ga0105348_1042133All Organisms → cellular organisms → Archaea1514Open in IMG/M
3300008954|Ga0115650_1379913All Organisms → cellular organisms → Archaea → TACK group622Open in IMG/M
3300009030|Ga0114950_10060565All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus2987Open in IMG/M
3300009030|Ga0114950_10420205All Organisms → cellular organisms → Archaea1072Open in IMG/M
3300009441|Ga0115007_10250477All Organisms → cellular organisms → Archaea1146Open in IMG/M
3300009488|Ga0114925_10296823All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon1096Open in IMG/M
3300009499|Ga0114930_10457975All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → unclassified Nitrosopumilaceae → Nitrosopumilaceae archaeon581Open in IMG/M
3300009528|Ga0114920_10215057All Organisms → cellular organisms → Archaea1281Open in IMG/M
3300009786|Ga0114999_11083216All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → environmental samples → uncultured marine thaumarchaeote SAT1000_10_G06576Open in IMG/M
3300009786|Ga0114999_11349114All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → environmental samples → uncultured marine thaumarchaeote SAT1000_10_G06504Open in IMG/M
3300009788|Ga0114923_10165880All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae1576Open in IMG/M
3300009788|Ga0114923_10295241All Organisms → cellular organisms → Archaea → TACK group1179Open in IMG/M
3300009788|Ga0114923_10301031All Organisms → cellular organisms → Archaea → TACK group1167Open in IMG/M
3300009788|Ga0114923_11566310All Organisms → cellular organisms → Archaea → TACK group518Open in IMG/M
3300009801|Ga0105056_1036401All Organisms → cellular organisms → Archaea → TACK group655Open in IMG/M
3300009822|Ga0105066_1068920All Organisms → cellular organisms → Archaea757Open in IMG/M
3300010392|Ga0118731_112501760All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.1685Open in IMG/M
3300010969|Ga0139246_1112868All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus2775Open in IMG/M
3300011013|Ga0114934_10119945All Organisms → cellular organisms → Archaea1263Open in IMG/M
3300011256|Ga0151664_1009827All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis9840Open in IMG/M
3300012284|Ga0116696_1074700Not Available631Open in IMG/M
3300013116|Ga0171646_1049689All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota1912Open in IMG/M
3300014872|Ga0180087_1120551All Organisms → cellular organisms → Archaea501Open in IMG/M
3300014873|Ga0180066_1021954All Organisms → cellular organisms → Archaea → TACK group1177Open in IMG/M
3300015256|Ga0180073_1149710All Organisms → cellular organisms → Archaea504Open in IMG/M
3300017768|Ga0187220_1268051All Organisms → cellular organisms → Archaea510Open in IMG/M
3300017949|Ga0181584_10696651All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.607Open in IMG/M
3300018031|Ga0184634_10205093All Organisms → cellular organisms → Archaea → TACK group898Open in IMG/M
3300018074|Ga0184640_10340964All Organisms → cellular organisms → Archaea → TACK group679Open in IMG/M
3300018077|Ga0184633_10007400All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota5143Open in IMG/M
3300018082|Ga0184639_10019522All Organisms → cellular organisms → Archaea3372Open in IMG/M
3300018426|Ga0181566_11028637All Organisms → cellular organisms → Archaea554Open in IMG/M
3300020175|Ga0206124_10084856All Organisms → cellular organisms → Archaea1329Open in IMG/M
3300020230|Ga0212167_1068854All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus2583Open in IMG/M
3300020232|Ga0212226_150414All Organisms → cellular organisms → Archaea2077Open in IMG/M
3300020234|Ga0212227_1302815All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus2797Open in IMG/M
3300020298|Ga0211657_1066149Not Available700Open in IMG/M
3300020347|Ga0211504_1005269All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis4455Open in IMG/M
3300020367|Ga0211703_10009106All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis → Candidatus Nitrosotenuis uzonensis2180Open in IMG/M
3300020376|Ga0211682_10398809All Organisms → cellular organisms → Archaea500Open in IMG/M
3300020389|Ga0211680_10009480All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus5451Open in IMG/M
3300020390|Ga0211555_10145259Not Available881Open in IMG/M
3300020399|Ga0211623_10320058All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.553Open in IMG/M
3300020407|Ga0211575_10172908Not Available900Open in IMG/M
3300020415|Ga0211553_10399049All Organisms → cellular organisms → Archaea555Open in IMG/M
3300020443|Ga0211544_10353033All Organisms → cellular organisms → Archaea586Open in IMG/M
3300021065|Ga0206686_1110370All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.818Open in IMG/M
3300021068|Ga0206684_1007637All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus3923Open in IMG/M
3300022201|Ga0224503_10006282All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus3401Open in IMG/M
3300022209|Ga0224497_10042130All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis2000Open in IMG/M
3300022214|Ga0224505_10272090All Organisms → cellular organisms → Archaea643Open in IMG/M
3300022220|Ga0224513_10163813All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis865Open in IMG/M
(restricted) 3300023109|Ga0233432_10279794All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.782Open in IMG/M
3300024058|Ga0209997_10574093All Organisms → cellular organisms → Archaea547Open in IMG/M
(restricted) 3300024059|Ga0255040_10322122All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.648Open in IMG/M
(restricted) 3300024062|Ga0255039_10025010All Organisms → cellular organisms → Archaea2145Open in IMG/M
3300024265|Ga0209976_10402486Not Available726Open in IMG/M
3300024265|Ga0209976_10653640All Organisms → cellular organisms → Archaea → TACK group551Open in IMG/M
(restricted) 3300024299|Ga0233448_1140555All Organisms → cellular organisms → Archaea627Open in IMG/M
3300024353|Ga0209979_1038716All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus2422Open in IMG/M
(restricted) 3300024521|Ga0255056_10155053All Organisms → cellular organisms → Archaea985Open in IMG/M
3300025150|Ga0210057_1354088All Organisms → cellular organisms → Archaea682Open in IMG/M
3300025262|Ga0208060_1024878All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → unclassified Thaumarchaeota → Thaumarchaeota archaeon909Open in IMG/M
3300025305|Ga0208684_1168581Not Available503Open in IMG/M
3300025322|Ga0209641_10355546All Organisms → cellular organisms → Archaea → TACK group1066Open in IMG/M
3300025323|Ga0209542_10460558Not Available972Open in IMG/M
3300025324|Ga0209640_10963795All Organisms → cellular organisms → Archaea659Open in IMG/M
3300025327|Ga0209751_10152756All Organisms → cellular organisms → Archaea → TACK group1991Open in IMG/M
3300025458|Ga0209559_1095140All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.532Open in IMG/M
3300025478|Ga0209576_1091380All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.590Open in IMG/M
3300025558|Ga0210139_1022063All Organisms → cellular organisms → Archaea → TACK group1230Open in IMG/M
3300026017|Ga0208001_1012818All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.757Open in IMG/M
3300026024|Ga0210130_1018144All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.850Open in IMG/M
3300026086|Ga0207964_1125077All Organisms → cellular organisms → Archaea593Open in IMG/M
3300026213|Ga0208131_1004612All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis → Candidatus Nitrosotenuis uzonensis3430Open in IMG/M
3300026254|Ga0208522_1141536All Organisms → cellular organisms → Archaea613Open in IMG/M
3300026483|Ga0228620_1088368All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.647Open in IMG/M
3300027413|Ga0208950_1011470All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus koreensis2887Open in IMG/M
3300027779|Ga0209709_10004814All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis10777Open in IMG/M
(restricted) 3300027799|Ga0233416_10001237All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota7939Open in IMG/M
(restricted) 3300027837|Ga0255041_10356133All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → unclassified Nitrosopumilus → Nitrosopumilus sp.535Open in IMG/M
3300027838|Ga0209089_10092575All Organisms → cellular organisms → Archaea1875Open in IMG/M
(restricted) 3300027868|Ga0255053_10437576All Organisms → cellular organisms → Archaea → TACK group633Open in IMG/M
(restricted) 3300027872|Ga0255058_10127201All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Nitrosopumilus maritimus1218Open in IMG/M
(restricted) 3300027872|Ga0255058_10192476All Organisms → cellular organisms → Archaea → TACK group978Open in IMG/M
3300027957|Ga0209857_1004640All Organisms → cellular organisms → Archaea2945Open in IMG/M
3300028274|Ga0257119_1065278All Organisms → cellular organisms → Archaea936Open in IMG/M
3300028535|Ga0257111_1257446All Organisms → cellular organisms → Archaea504Open in IMG/M
3300028598|Ga0265306_10085698All Organisms → cellular organisms → Archaea1606Open in IMG/M
3300028599|Ga0265309_10006211All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis5665Open in IMG/M
3300028600|Ga0265303_10028212All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → Nitrosopumilaceae → Nitrosopumilus → Candidatus Nitrosopumilus sediminis3830Open in IMG/M
3300028600|Ga0265303_11518720All Organisms → cellular organisms → Archaea559Open in IMG/M
3300031576|Ga0247727_10001158All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Candidatus Nitrosotenuis → Candidatus Nitrosotenuis cloacae64246Open in IMG/M
3300031576|Ga0247727_10020329All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota10167Open in IMG/M
3300031576|Ga0247727_10048159All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota5275Open in IMG/M
3300031660|Ga0307994_1117134All Organisms → cellular organisms → Archaea930Open in IMG/M
3300031757|Ga0315328_10229912All Organisms → cellular organisms → Archaea1085Open in IMG/M
3300031766|Ga0315322_10221281All Organisms → cellular organisms → Archaea1320Open in IMG/M
3300031773|Ga0315332_10574328All Organisms → cellular organisms → Archaea → TACK group704Open in IMG/M
3300031801|Ga0310121_10012201All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota6643Open in IMG/M
3300032018|Ga0315272_10695325All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Nitrosopumilales → unclassified Nitrosopumilales → Nitrosopumilales archaeon CG_4_9_14_0_8_um_filter_34_10517Open in IMG/M
3300032173|Ga0315268_10309698All Organisms → cellular organisms → Archaea1531Open in IMG/M
3300032277|Ga0316202_10158707All Organisms → cellular organisms → Archaea1051Open in IMG/M
3300032278|Ga0310345_10209124All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota1772Open in IMG/M
3300033233|Ga0334722_10000888All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota40875Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Marine12.81%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine11.33%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface6.40%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine5.91%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine4.93%
MarineEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Marine4.43%
SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Sediment2.96%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment2.46%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater2.46%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.97%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.97%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.97%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment1.97%
Sediment (Intertidal)Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)1.97%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil1.97%
Deep OceanEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean1.48%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater1.48%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.48%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.48%
SeawaterEnvironmental → Aquatic → Marine → Gulf → Unclassified → Seawater1.48%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.48%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand1.48%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm1.48%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.99%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater0.99%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.99%
Marine EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine Estuarine0.99%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.99%
Hydrothermal Vent PlumeEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume0.99%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.99%
Delisea PulchraHost-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra0.99%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Sediment0.49%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater0.49%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.49%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.49%
MarineEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine0.49%
Microbial MatEnvironmental → Aquatic → Marine → Coastal → Sediment → Microbial Mat0.49%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous0.49%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater0.49%
Marine Surface WaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine Surface Water0.49%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine0.49%
Marine (Brackish)Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine (Brackish)0.49%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.49%
Methane Seep MesocosmEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm0.49%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater0.49%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine0.49%
Hydrothermal Chimney Microbial MatEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Chimney Microbial Mat0.49%
MarineEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Marine0.49%
Hydrothermal VentsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents0.49%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface0.49%
WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water0.49%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.49%
Beach SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Beach Sand0.49%
Coelocarteria Singaporensis (Marine Sponge)Host-Associated → Porifera → Unclassified → Unclassified → Unclassified → Coelocarteria Singaporensis (Marine Sponge)0.49%
Drinking Water PipesEngineered → Built Environment → Unclassified → Unclassified → Unclassified → Drinking Water Pipes0.49%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2061766003Hydrothermal vent microbial communities from Guaymas and Carmen Basins, Gulf of California, Sample 457EnvironmentalOpen in IMG/M
2088090013Freshwater sediment microbial communities from Lake Washington, Seattle, for methane and nitrogen Cycles - SIP 13Cmethane anaerobic no nitrateEnvironmentalOpen in IMG/M
2236876008Marine microbial communities from Columbia River, CM, sample from Cape Meares, GS311-3LG-Deep1200EnvironmentalOpen in IMG/M
2236876009Marine microbial communities from Columbia River, CM, sample from Newport Hydroline, GS310-0p8-Hyp-75mEnvironmentalOpen in IMG/M
2263196002April 2009 400 m contigsEnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000136Marine microbial communities from chronically polluted sediments in Antarctica - King George Island site S1 sample ANT 02_9.5mEnvironmentalOpen in IMG/M
3300000141Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P4 1300mEnvironmentalOpen in IMG/M
3300000142Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P16 500mEnvironmentalOpen in IMG/M
3300000143Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 53 01/11/11 10mEnvironmentalOpen in IMG/M
3300000152Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2008 P12 500mEnvironmentalOpen in IMG/M
3300000155Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 200mEnvironmentalOpen in IMG/M
3300000157Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2008 P26 1000mEnvironmentalOpen in IMG/M
3300000164Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 200mEnvironmentalOpen in IMG/M
3300000170Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 135mEnvironmentalOpen in IMG/M
3300000179Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P16 500mEnvironmentalOpen in IMG/M
3300000186Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - February 2010 P16 2000mEnvironmentalOpen in IMG/M
3300000222Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - June 2009 P12 500mEnvironmentalOpen in IMG/M
3300000238Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 36 08/11/09 100mEnvironmentalOpen in IMG/M
3300000254Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 100mEnvironmentalOpen in IMG/M
3300000256Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - ample_F_10_SI03_120EnvironmentalOpen in IMG/M
3300000259Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - sample_J_08_P26_500EnvironmentalOpen in IMG/M
3300000323Marine microbial communities from expanding oxygen minimum zones in Line P, North Pacific Ocean - August 2009 P20 2000mEnvironmentalOpen in IMG/M
3300000574Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 mEnvironmentalOpen in IMG/M
3300000950Marine microbial communities from the Deep Atlantic Ocean - MP0441EnvironmentalOpen in IMG/M
3300001073Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 2EnvironmentalOpen in IMG/M
3300001133Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3EnvironmentalOpen in IMG/M
3300001380Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW37 contaminated, 5.8 mEnvironmentalOpen in IMG/M
3300001683Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assemblyEnvironmentalOpen in IMG/M
3300001771Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Beebe SitesEnvironmentalOpen in IMG/M
3300001959Mangrove swamp microbial communities from Isabella Island, Equador - GS032EnvironmentalOpen in IMG/M
3300001968Marine microbial communities from Lake Gatun, Panama - GS020EnvironmentalOpen in IMG/M
3300002036Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_BI_B3Host-AssociatedOpen in IMG/M
3300002231Marine sediment microbial communities from Santorini caldera mats, Greece - red matEnvironmentalOpen in IMG/M
3300002965Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - NADW_A/KNORR_S2/LVEnvironmentalOpen in IMG/M
3300003153Marine microbial communities from deep-sea hydrothermal vent plumes in the Guaymas BasinEnvironmentalOpen in IMG/M
3300004150Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D1EnvironmentalOpen in IMG/M
3300004213Groundwater microbial communities from aquifer - Crystal Geyser CG19_WC_8/21/14_NAEnvironmentalOpen in IMG/M
3300004278Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_150mEnvironmentalOpen in IMG/M
3300005427Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65EnvironmentalOpen in IMG/M
3300005589Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.2EnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005592Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV89EnvironmentalOpen in IMG/M
3300005593Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV86EnvironmentalOpen in IMG/M
3300005600Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.1EnvironmentalOpen in IMG/M
3300005601Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.1EnvironmentalOpen in IMG/M
3300005825Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.184_BBBEnvironmentalOpen in IMG/M
3300005828Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.182_BBIEnvironmentalOpen in IMG/M
3300005829Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBCEnvironmentalOpen in IMG/M
3300005945Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_AAIW_ad_876m_LV_BEnvironmentalOpen in IMG/M
3300005951Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_250_ad_251m_LV_AEnvironmentalOpen in IMG/M
3300006019Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_NADW_ad_2500m_LV_AEnvironmentalOpen in IMG/M
3300006027Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNAEnvironmentalOpen in IMG/M
3300006166Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV91EnvironmentalOpen in IMG/M
3300006308Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0500mEnvironmentalOpen in IMG/M
3300006310Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_3_0500mEnvironmentalOpen in IMG/M
3300006313Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_2_0770mEnvironmentalOpen in IMG/M
3300006315Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT233_1_0770mEnvironmentalOpen in IMG/M
3300006316Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT229_1_1000mEnvironmentalOpen in IMG/M
3300006325Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT238_1_0500mEnvironmentalOpen in IMG/M
3300006339Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT232_3_0500mEnvironmentalOpen in IMG/M
3300006341Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT236_2_0770mEnvironmentalOpen in IMG/M
3300006346Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0770mEnvironmentalOpen in IMG/M
3300006414Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0500mEnvironmentalOpen in IMG/M
3300006421Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten IEnvironmentalOpen in IMG/M
3300006466Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten VIEnvironmentalOpen in IMG/M
3300006567Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0770mEnvironmentalOpen in IMG/M
3300006643Marine coastal surface water microbial communities in Port Hacking, Sydney, Australia ? TJ11 time pointEnvironmentalOpen in IMG/M
3300006872Biofilm microbial communities from drinking water pipes in SingaporeEngineeredOpen in IMG/M
3300006902Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_250_ad_251m_LV_AEnvironmentalOpen in IMG/M
3300006958Marine sponge C. singaporensis. microbiome, Papua New Guinea CO2 seep, Upa-Upasina 'bubble', co31isHost-AssociatedOpen in IMG/M
3300007283Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_250_ad_252m_LV_BEnvironmentalOpen in IMG/M
3300007291Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_AAIW_ad_750m_LV_AEnvironmentalOpen in IMG/M
3300007760Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 237m, 250-2.7um, replicate aEnvironmentalOpen in IMG/M
3300007778Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_C_H2O_MGEnvironmentalOpen in IMG/M
3300008223Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN8C Hudson CanyonEnvironmentalOpen in IMG/M
3300008954Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 247m, 250-2.7umEnvironmentalOpen in IMG/M
3300009030Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N075 metaGEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009488Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaGEnvironmentalOpen in IMG/M
3300009499Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaGEnvironmentalOpen in IMG/M
3300009528Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaGEnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300009788Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaGEnvironmentalOpen in IMG/M
3300009801Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_20_30EnvironmentalOpen in IMG/M
3300009822Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_30_40EnvironmentalOpen in IMG/M
3300010392Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385EnvironmentalOpen in IMG/M
3300010969Microbial communities from the outside layer of the microbial mat covering an inactive hydrothermal chimney from the Kolumbo submarine volcano, Santorini, Greece - V16_c.outEnvironmentalOpen in IMG/M
3300011013Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaGEnvironmentalOpen in IMG/M
3300011256Marine sediment microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_4, totalEnvironmentalOpen in IMG/M
3300012284Beach sand microbial communities from Municipal Pensacola Beach, Florida - OS-S2EnvironmentalOpen in IMG/M
3300013116Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 103m, 2.7-0.2um, replicate bEnvironmentalOpen in IMG/M
3300014872Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT790_16_10DEnvironmentalOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300015256Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10DEnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017949Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018031Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1EnvironmentalOpen in IMG/M
3300018074Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2EnvironmentalOpen in IMG/M
3300018426Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101402AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020230Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR02EnvironmentalOpen in IMG/M
3300020232Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR05EnvironmentalOpen in IMG/M
3300020234Deep-sea sediment microbial communities from the Kermadec Trench, Pacific Ocean - N074EnvironmentalOpen in IMG/M
3300020298Marine microbial communities from Tara Oceans - TARA_B100000953 (ERX556051-ERR599128)EnvironmentalOpen in IMG/M
3300020347Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556109-ERR598994)EnvironmentalOpen in IMG/M
3300020367Marine microbial communities from Tara Oceans - TARA_B100000508 (ERX556112-ERR599005)EnvironmentalOpen in IMG/M
3300020376Marine microbial communities from Tara Oceans - TARA_B100000795 (ERX555997-ERR599121)EnvironmentalOpen in IMG/M
3300020389Marine microbial communities from Tara Oceans - TARA_B100000809 (ERX556139-ERR599008)EnvironmentalOpen in IMG/M
3300020390Marine microbial communities from Tara Oceans - TARA_B100002049 (ERX555953-ERR598985)EnvironmentalOpen in IMG/M
3300020399Marine microbial communities from Tara Oceans - TARA_B100000470 (ERX555969-ERR598947)EnvironmentalOpen in IMG/M
3300020407Marine microbial communities from Tara Oceans - TARA_B100001105 (ERX556033-ERR599115)EnvironmentalOpen in IMG/M
3300020415Marine microbial communities from Tara Oceans - TARA_B100001146 (ERX555973-ERR599166)EnvironmentalOpen in IMG/M
3300020443Marine microbial communities from Tara Oceans - TARA_B100001179 (ERX556000-ERR598944)EnvironmentalOpen in IMG/M
3300021065Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 500m 12015EnvironmentalOpen in IMG/M
3300021068Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 100m 12015EnvironmentalOpen in IMG/M
3300022201Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21EnvironmentalOpen in IMG/M
3300022209Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_13EnvironmentalOpen in IMG/M
3300022214Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022220Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_21EnvironmentalOpen in IMG/M
3300023109 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MGEnvironmentalOpen in IMG/M
3300024058Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR04 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024062 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1EnvironmentalOpen in IMG/M
3300024265Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024299 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_150_MGEnvironmentalOpen in IMG/M
3300024353Deep subsurface microbial communities from Anholt, Denmark to uncover new lineages of life (NeLLi) - Anholt_01485 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024521 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_1EnvironmentalOpen in IMG/M
3300025150Groundwater microbial communities from aquifer - Crystal Geyser CG10_big_fil_rev_8/21/14_0.10 (SPAdes)EnvironmentalOpen in IMG/M
3300025262Marine microbial communities from the Deep Indian Ocean - MP0901 (SPAdes)EnvironmentalOpen in IMG/M
3300025305Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_b05 (SPAdes)EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025323Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank highO2_0.1 (SPAdes)EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025327Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025458Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_110m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025478Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_135m (SPAdes)EnvironmentalOpen in IMG/M
3300025558Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300026017Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Joice_CattailNLC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026024Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - White_ThreeSqC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026086Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_250_ad_251m_LV_A (SPAdes)EnvironmentalOpen in IMG/M
3300026213Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV73 (SPAdes)EnvironmentalOpen in IMG/M
3300026254Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV86 (SPAdes)EnvironmentalOpen in IMG/M
3300026483Seawater microbial communities from Monterey Bay, California, United States - 23DEnvironmentalOpen in IMG/M
3300027413Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - CAN11_54_BLW_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027799 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MGEnvironmentalOpen in IMG/M
3300027837 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_3EnvironmentalOpen in IMG/M
3300027838Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027868 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_22EnvironmentalOpen in IMG/M
3300027872 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_9EnvironmentalOpen in IMG/M
3300027957Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300028274Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_200mEnvironmentalOpen in IMG/M
3300028535Marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_500mEnvironmentalOpen in IMG/M
3300028598Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300028599Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160524 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300028600Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160317 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031660Marine microbial communities from Ellis Fjord, Antarctic Ocean - #261EnvironmentalOpen in IMG/M
3300031757Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315EnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031773Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 34915EnvironmentalOpen in IMG/M
3300031801Marine microbial communities from Western Arctic Ocean, Canada - CB27_Tmax_986EnvironmentalOpen in IMG/M
3300032018Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_middleEnvironmentalOpen in IMG/M
3300032173Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_topEnvironmentalOpen in IMG/M
3300032277Microbial mat bacterial communities from mineral coupon in-situ incubated in ocean water Damariscotta River, Maine, United States - 3-month pyrrhotiteEnvironmentalOpen in IMG/M
3300032278Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-500_MGEnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
GB_4MN_026796302061766003Hydrothermal VentsILYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK
LWAnNN_051576402088090013Freshwater SedimentTIPYYMIQCEYCPRGFIDTANGLAEKTFHELLHEPEVVNK
none_54316722236876008Marine EstuarineTVP*YMIRCKYCTKNFIESMNGLTERTFHEILHEPEIVNQ
none_08565412236876009Marine EstuarineTIQYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK
LD2009400mD_0278222263196002Marine (Brackish)MIQCEYCPRGFIETVNGLAEKTFHELLHEPTVVNK
DelMOWin2010_1006527823300000117MarineMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK*
KGI_S1_ANT02_95mDRAFT_1003840423300000136MarineMIQCEYCPRGFIETVNGLAEKTFHELLHEPTVVNK*
LPjun08P41300mDRAFT_100748013300000141MarineGTVLYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK*
LPjun08P41300mDRAFT_104575323300000141MarineTVQYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK*
LPaug09P16500mDRAFT_104089623300000142MarineTVP*YMIQCKYCTKNFIESMNGLTERTFHEILHEPKIVNQ*
LPaug09P16500mDRAFT_106649513300000142MarineTVP*YMIRCKYCTKNFIESMNGLTERTFHEILHEPKIVNQ*
SI53jan11_10mDRAFT_10126323300000143MarineMIQCEYCPRGFIETTTGLAEKTFHELLHEPEVVNK*
LPjun08P12500mDRAFT_104344823300000152MarineMIQCEYCAKNFMESMNGLAEKTFHEMLHTPEIVNQ*
SI36aug09_200mDRAFT_101372013300000155MarineTILYYMIQCEFCTRGFIETANGLAEKTFHELLHEPTIVNK*
LPaug08P261000mDRAFT_104824623300000157MarineMIQCDYCTKSFVESMNGLAEKTFHEILHAPKIVNQ*
SI39no09_200mDRAFT_105175213300000164MarineTVQYYMIQCEYCPRGFIETTTGLAEKTFHELLHEPEVVNK*
SI36aug09_135mDRAFT_102941313300000170MarineCMIQCEYCTRGFIETHNGLAEKTFHELLHEPTVVNK*
LPjun09P16500mDRAFT_104837923300000179MarineYYMIQCDYCTRNFVENMNGLAEKTFHEMLHEPEVVNQ*
LPfeb10P162000mDRAFT_100436023300000186MarineMIQCEYCDKNFIESMNGLAEKTFHEMLHAPEIVNQ*
LPjun09P12500mDRAFT_102416623300000222MarineMIQCEYCPRGFIXTTNGLAEKTFHELLHEPEVVNK*
LPjun09P12500mDRAFT_107245623300000222MarineMIQCEFCTRGFIETVNGLAEKTFHELLHEPIVVNK*
SI36aug09_100mDRAFT_104486723300000238MarineMIQCEFCTRGFIETANGLAEKTFHELLHEPTIVNK*
SI34jun09_100mDRAFT_100238373300000254MarineYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK*
LP_F_10_SI03_120DRAFT_101770123300000256MarineMIQCEYCPRGFIETTNGLAEKTFHEXLHEPEVVNK*
LP_J_08_P26_500DRAFT_100654813300000259MarineMLECEYCEQHFIETRNGLVEKTFHELLHDPETVNK*
LPaug09P202000mDRAFT_101723923300000323MarineYGTVLYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK*
JGI1357J11328_10000232433300000574GroundwaterMIQCEYCPRGFIDTAIGLAEKTFHELLHEPEVVNK*
JGI11881J13070_100406513300000950Deep OceanYGTIPYYMIQCEFCTRGFIDTANGLAEKTFHELLHEPRVVNK*
C687J13245_10009243300001073SoilIVCEYCPEKFVENMNGLVEKTFHELLHEPEMVNK*
C687J13250_10035423300001133SoilMIVCEYCPEKFVENMNGLVEKTFHELLHEPEMVNK*
JGI1356J14229_1016401223300001380GroundwaterYGTIPYYMIQCEYCPRGFIDTAIGLAEKTFHELLHEPEVVNK*
GBIDBA_1006073533300001683Hydrothermal Vent PlumeMIQCEYCPRGFIDTTNGLAEKTFHELLHEPEVVNK*
Beebe_105106913300001771Hydrothermal Vent PlumeIQCEYCDKNFIESMNGLAEKTFHEMLHAPEIVNQ*
GOS2247_106611923300001959MarineMIQCEYCTRGFIETANGLAEKTFHELLHAPEVVNK*
GOS2236_100328923300001968MarineDMITCEYCTKQFVESMTGLTEKTLHEILHGPELVNE*
BIB32012_1011751313300002036Delisea PulchraMIQCEYCTRGFVDTANGLVAKTFHELLHEPDVVNK*
BIB32012_1013597023300002036Delisea PulchraMIECEYCPREFIETANGLAEKTFHELLHEPEVVNK*
KVRMV2_10012137423300002231Marine SedimentMIQCEYCPKGFIETANGLAEKTFHELLHEPNVVNK*
KVRMV2_10192747913300002231Marine SedimentMIACEYCPEKFIENMNGLAEKTFHELLHEPKMVNK*
JGI26063J44948_105290313300002965MarineVLYYMIQCEYCPRGFIDTTNGLAEKTFHELLHEPEVVNK*
Ga0052192_100103353300003153MarineILYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK*
Ga0055520_1016608813300004150Natural And Restored WetlandsIPYYMIQCDYCPRGFIETANGLAEKTFHELLHEPEVVNK*
Ga0066648_1066068813300004213GroundwaterTQALIVGTIPYYMIQCEYCPRGFIDTANGLAEKTFHELLHEPEVVNK*
Ga0066609_1005744613300004278MarineYGTVQYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK*
Ga0066851_1006612613300005427MarineVLYYMIQCEYCERGFIETINGLAEKTFHEIICSPEVSNK*
Ga0070729_1041478523300005589Marine SedimentMIQCEYCPRGFIETVNGLAEKTFHELLHEPEVVNK*
Ga0070727_1002668323300005590Marine SedimentMIQCEFCPQGFIETANGLAEKTFHELLHEPNVVNK*
Ga0066838_1010203323300005592MarineMIQCEYCSRGFVDTMNGLAEKTFHEVLHAPKIVNQ*
Ga0066837_10000839203300005593MarineMIECTYCKRGFVESMNGLAEKTFHELLHEPETVNN*
Ga0066837_1010390313300005593MarineMLQCEYCERGFIETHNGLAEKTIHEMLHEPETVNK*
Ga0070726_1017874423300005600Marine SedimentMIQCEYCPRGFIETANGLAEKTFHELLHEPEVVNK*
Ga0070722_1000588523300005601Marine SedimentMIQCEYCPQGFIDTANGLAEKTFHELLHEPEVVNK*
Ga0070722_1002071923300005601Marine SedimentMIECEYCPRGFIETANGLAEKTFHELLHEPEVVNK*
Ga0074476_139559023300005825Sediment (Intertidal)MIQCDYCPRGFIETANGLAEKTFHELLHEPEVVNK*
Ga0074475_1097519923300005828Sediment (Intertidal)AINSTTIPYYMIQCDYCPRGFIETANGLAEKTFHELLHEPEVVNK*
Ga0074479_1009040243300005829Sediment (Intertidal)MIQCEYCPRGFIDTANGLAEKTFHELLHEPEVVNK*
Ga0074479_10767911483300005829Sediment (Intertidal)MITCEYCTKQFVESLTGLTEKTFHEILHDPKMVNE*
Ga0066381_1015650813300005945MarineMIRCKYCTKNFIESMNGLTERTFHEILHEPKIVNQ*
Ga0066381_1019584423300005945MarineYMIQCNYCTKSFIESMNGLAEKTFHEILHKPEIVNQ*
Ga0066379_1000373533300005951MarineMIECTYCKRGFVESMNGLAEKTFHELLHEPKTVNN*
Ga0066379_1014332323300005951MarineMIKCNYCPKGFVENMNGLAEKTFHEILHEPEIVNQ*
Ga0066379_1027633923300005951MarineMLECEYCQQHFVENRNGLAEKTFHEILHDPEIINN*
Ga0066375_1005097523300006019MarineMIQCEFCTRGFIDTANGLAEKTFHELLHEPQVVNK*
Ga0075462_1023884713300006027AqueousMIQCEYCARGFIETTNGLAEKTFHELLHEPEVVNK*
Ga0066836_1003142723300006166MarineMLECEYCEQHFIENRNGLAEKTFHELLHDPETVNK*
Ga0068470_128325223300006308MarineMIQCEYCAKNFMESMNGLAEKTFHEMLHAPEIVNQ*
Ga0068470_140868713300006308MarineMIQCDYCAKNFVVNMNGLAEKTFHEMLHEPEIVNQ
Ga0068470_172671113300006308MarineHMIQCEYCTRSFVESMNGLAEKTFHEILHEPEIVNQ*
Ga0068471_1110725103300006310MarineMIQCEYCTENFIESMNGLAEKTFHEMLHAPEIVNQ*
Ga0068471_112725413300006310MarineMIQCDYCTKNFVENMNGLAEKTFHEMLHEPEIVNH
Ga0068471_153702323300006310MarineMIQCEYCAKNFIESMNGLAEKTFHEMLHAPEIVNQ*
Ga0068472_1041639613300006313MarineMIQCEYCTKNFVENMNGLAEKTFHEMLHEPKIVNQ*
Ga0068472_1041639723300006313MarineMIECEYCTKNFVESMNGLAEKTFHEMLHEPKIVNQ*
Ga0068472_1050783123300006313MarineMIQCEYCAKNFIESMNGLAEKTFHEILHAPEIVNQ*
Ga0068472_1073942623300006313MarineVPYYMIQCDYCTRNFVENMNGLAEKTFHEMLHEPEVVNQ*
Ga0068487_102529733300006315MarineMLECQYCSQHFVENRNGLAEKTFHEILHDPEIINN*
Ga0068473_173056313300006316MarineYMIQCEYCTKSFVESMNGLAEKTFHEVLHEPEIVNQ*
Ga0068473_173644033300006316MarineIECEYCTKNFVESMNGLAEKTFHEMLHEPEIVNQ*
Ga0068501_132487813300006325MarineMIQSEYCTKNFVESMNGLIEKTFHILLHEPRIVNQ*YP
Ga0068481_142812123300006339MarineMIQCEYCTKNFIESMNGLAEKTFHEMLHAPEIVNQ*
Ga0068493_1046990023300006341MarineMIQCEYCAKNFVENMNGLAEKTFHEMLHEPKIVNQ*
Ga0099696_111495613300006346MarineIQCEYCTKSFVESMNGLAEKTFHEVLHEPEIVNQ*
Ga0099957_107838923300006414MarineMIQCEYCAKNFIESMNGLAEKTFHEMLHTPEIVNQ*
Ga0099957_1108994103300006414MarineMIQCEYCTKSFVESMNGLAEKTFHEVLHEPEIVNQ*
Ga0099957_128549923300006414MarineMIQCEYCSRSFVDTMNGLAEKTFHEVLHAPKIVNQ*
Ga0082247_1000002423300006421SedimentMIQCEYCPRGFIETSNGLAEKTFHELLHEPNVVNK*
Ga0082247_1028385023300006421SedimentYGTIPYYMIQCEFCPKGFIETHNGLAEKTFHELLHEPNVVNK*
Ga0082249_1066478923300006466SedimentMIQCEYCPKGFIETHNGLAEKTFHELLHEPEMVNR*
Ga0099958_111261323300006567MarineMIECEYCTKNFVESMNGLAEKTFHEMLHEPEIVNQ*
Ga0099958_125092623300006567MarineMIECEYCTKNFVENMNGLAEKTFHEMLHEPKIVNQ*
Ga0101445_10030423300006643Marine Surface WaterMIQCEYCTRGFIETTNGLAEKTFHELLHEPEVVNK*
Ga0101947_100677143300006872Drinking Water PipesMITCEYCTKQFVESMNGLTEKTLHEILHGPELVNE*
Ga0066372_1095026523300006902MarineMIQCEYCSKGFVDTMNGLAEKTFHEVLHAPKIVNQ*
Ga0101660_10014523300006958Coelocarteria Singaporensis (Marine Sponge)MIQCEYCTKGFIETANGLAEKTFHELLHGAKVVNK*
Ga0066366_1037038323300007283MarineIECTYCKRGFVESMNGLAEKTFHELLHEPATVNN*
Ga0066367_105145813300007291MarineIQCEYCNKNFIASMNGLAEKTFHEILHAPEIVNQ*
Ga0105018_105098013300007760MarineTMLQCEYCERGFIETHNGLAEKTMHEMLHEPETVNK*
Ga0102954_127938813300007778WaterMIQCEYCPRGFIDTANGLVAKTFHELLHEPEVVNK*
Ga0105348_104213313300008223Methane Seep MesocosmMIQCEYCPRGFVETTNGLAEKTFHELLHEPEVVNK*
Ga0115650_137991313300008954MarineTVTMLQCEYCERGFIETHNGLAEKTMHEMLHEPETVNK*
Ga0114950_1006056533300009030Deep SubsurfaceMIQCEYCTRGFIETMNGLAEKTFHELLHEPRVVNK*
Ga0114950_1042020523300009030Deep SubsurfaceMIECEYCPRGFIETANGLAEKTIHELLHEPQVVNK*
Ga0115007_1025047713300009441MarineMIQCEYCPRGFIETTNGLAEKTFHELLHDPEVVNK*
Ga0114925_1029682323300009488Deep SubsurfaceIQCEFCPQGFIETANGLAEKTFHELLHEPNVVNK*
Ga0114930_1045797513300009499Deep SubsurfaceYMIQCEYCPMGFIETANGLAEKTFHELLPAPNVVNK*
Ga0114920_1021505723300009528Deep SubsurfaceMIACEYCPEKFIENMNGLVEKTFHELLHEPEMVNK*
Ga0114999_1108321613300009786MarineMIQCEYCPRGFIETATGLAEKTFHELLHEPEVVNK*
Ga0114999_1134911413300009786MarineMIQCEYCPRGFIDTTTGLAEKTFHELLHEPEVVNK*
Ga0114923_1016588023300009788Deep SubsurfaceMIACEYCPEKFIENMNGLVEKTFHELLHEPEMVNE*
Ga0114923_1029524123300009788Deep SubsurfaceTMIICEYCPEKFIENMNGLVEKTFHELLHEPAMVNK*
Ga0114923_1030103113300009788Deep SubsurfaceIACEYCPEKFIENMNGLVEKTFHELLHEPEMVNE*
Ga0114923_1156631023300009788Deep SubsurfaceMIICEYCPEKFIENMNGLVEKTFHELLHEPEMVNK*
Ga0105056_103640113300009801Groundwater SandNFMITCEFCPERFIESMNGLVEKTFHELLHEPEMVNK*
Ga0105066_106892013300009822Groundwater SandMIVCEYCPERFIENMNGLVEKTFHELLHEPEMVNK*
Ga0118731_11250176013300010392MarineIPYYMIECEYCPRGFIETANGLAEKTFHELLHEPEVVNK*
Ga0139246_111286833300010969Hydrothermal Chimney Microbial MatMVPYYMIQCEYCPRGFIETANGLAEKTFHELLHEPEVVNK*
Ga0114934_1011994523300011013Deep SubsurfaceIWYGTIRYYMIECTYCKRGFVESMNGLAEKTFHELLHEPKTVNN*
Ga0151664_100982783300011256MarineMIQCEYCPRGFIETVNGLAEKTFHELLHEPDVVNK*
Ga0116696_107470023300012284Beach SandMIQCEYCQRGFVESSNGLTEKIFHELLHEPEVVNH*
Ga0171646_104968923300013116MarineMLECEYCSQHFVENRNGLAEKTFHEILHDPEIINN*
Ga0180087_112055113300014872SoilMITCEYCPEKFVENMNGLVVKTFHELLHEPEMVNK*
Ga0180066_102195413300014873SoilMIVCEYCPEKFVENMNGLVVKTFHELLHEPEIVNK*
Ga0180073_114971013300015256SoilMITCEYCPEKFVENMNGLVVKTFHELLHEPEIVNK*
Ga0187220_126805113300017768SeawaterMIQCEYCARGFIETSNGLAEKTFHELLHEPEVVNK
Ga0181584_1069665123300017949Salt MarshMIQCEYCPRGFIETANGLAEKTFHELLHEPEVVNK
Ga0184634_1020509323300018031Groundwater SedimentMIVCEYCPEKFIESMNGLVEKTFHELLHAPEMVNK
Ga0184640_1034096413300018074Groundwater SedimentMIVCEYCPEKFVENMNGLVVKTFHELLHEPEIVNK
Ga0184633_1000740043300018077Groundwater SedimentMIVCEYCPEKFVENMNGLVVKTFHELLHEPEMVNK
Ga0184639_1001952253300018082Groundwater SedimentMIVCEYCPEKFIESMNGLVEKTFHELLHEPEMVNK
Ga0181566_1102863713300018426Salt MarshMLQCEYCPRGFIETANGLAEKTFHELIHEPEVVNK
Ga0206124_1008485623300020175SeawaterMIQCEYCARGFIETTNGLAEKTFHELLHEPEVVNK
Ga0212167_106885433300020230SedimentMIECEYCPRGFIETANGLAEKTIHELLHEPQVVNK
Ga0212226_15041423300020232SedimentMIQCEYCPKGFIETVNGLAEKTFHELLHEPRVVNK
Ga0212227_130281533300020234SedimentMIQCEYCPKGFIETHNGLAEKTFHELLHEPEMVNR
Ga0211657_106614913300020298MarineMIRCKYCTKNFIESMNGLTERTFHEILHEPEIVNQ
Ga0211504_100526963300020347MarineMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK
Ga0211703_1000910633300020367MarineMIQCEYCDKNFIESMNGLAEKTFHEMLHAPEIVNQ
Ga0211682_1039880913300020376MarineMIQCEYCPRGFIETTTGLAEKTFHELLHEPEVVNK
Ga0211680_1000948023300020389MarineMIQCEYCPRGFIDTTNGLAEKTFHELLHEPEVVNK
Ga0211555_1014525913300020390MarineMIQCEYCSKNFVESMNGLAEKTFHEMLHAPEIVNQ
Ga0211623_1032005823300020399MarineMIQCEYCPRGFVETTNGLAEKTFHELLHEPEVVNK
Ga0211575_1017290813300020407MarineYMIQCDYCTKSFVENMNGLAEKTFHEMLHEPEIVNQ
Ga0211553_1039904923300020415MarineMIQCDYCTKSFVESMNGLAEKTFHEILHEPEIVNQ
Ga0211544_1035303313300020443MarineMLECEYCEQYFIESRNGLAEKTFHELLHDPETVNK
Ga0206686_111037023300021065SeawaterLYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK
Ga0206684_100763733300021068SeawaterYYMIQCEFCTRGFIETVNGLAEKTFHELLHEPIVVNK
Ga0224503_1000628233300022201SedimentMIQCEYCPRGFIDTANGLVAKTFHELLHEPEVVNK
Ga0224497_1004213023300022209SedimentMVPYYMIQCEYCPKGFIETANGLAEKTFHELLHEPEVVNK
Ga0224505_1027209013300022214SedimentCMIQCEYCPRGFIETSNGLAEKTFHELLHEPEVVNK
Ga0224513_1016381323300022220SedimentMIECEYCPRGFIETANGLAEKTFHELLHEPEVVNK
(restricted) Ga0233432_1027979423300023109SeawaterVQYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK
Ga0209997_1057409323300024058Deep SubsurfaceMIRCEYCPKGFVESHNGLVEKTFHELLHEPEMINR
(restricted) Ga0255040_1032212213300024059SeawaterYGTIPYYMIQCEYCPKGFIETANGLAEKTFHELLHEPRVVNK
(restricted) Ga0255039_1002501023300024062SeawaterMIQCEYCPRGFIETVNGLAEKTFHELLHEPEVVNK
Ga0209976_1040248623300024265Deep SubsurfaceMIACEYCPEKFIENMNGLVEKTFHELLHEPEMVNE
Ga0209976_1065364023300024265Deep SubsurfaceYWYRNNMIICEYCPEKFIENMNGLVEKTFHELLHEPEMVNK
(restricted) Ga0233448_114055513300024299SeawaterMIQCEFCTRGFIETVNGLAEKTFHELLHEPTIVNK
Ga0209979_103871613300024353Deep SubsurfaceYMIQCEFCPMGFIETANGLAEKTFHELLHEPNVVNK
(restricted) Ga0255056_1015505323300024521SeawaterMIQCEYCPKGFIETTNGLAEKTFHELLHEPETVNK
Ga0210057_135408823300025150GroundwaterMIQCEYCPRGFIDTANGLAEKTFHELLHEPEVVNK
Ga0208060_102487833300025262Deep OceanYMIECEYCTKNFVESMNGLAEKTFHEMLHEPEIVNQ
Ga0208684_116858113300025305Deep OceanMIQCEYCSRNFVESMNGLVEKTFHILLHEPEIVNQ
Ga0209641_1035554613300025322SoilMITCEYCPEKFVENMNGLVVKTFHELLHEPEMVNK
Ga0209542_1046055823300025323SoilTTMITCEYCPRGFVESPNGLVEKTLHEVLHSPEVVNK
Ga0209640_1096379523300025324SoilPYHMIQCEYCPRGFIDTAIGLAEKTFHELLHEPEVVNK
Ga0209751_1015275633300025327SoilMIVCEYCPEKFVENMNGLVEKTFHELLHEPEMVTIPLPDY
Ga0209559_109514013300025458MarineVLYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK
Ga0209576_109138023300025478MarineGTVQYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK
Ga0210139_102206323300025558Natural And Restored WetlandsMINCEYCPEKFIESMNGLVEKTFHELLHEPEMVNE
Ga0208001_101281813300026017Natural And Restored WetlandsVPYNMIQCEYCPRGFIETANGLAEKTFHELLHEPEVVNK
Ga0210130_101814413300026024Natural And Restored WetlandsIPYYMIQCDYCPRGFIETANGLAEKTFHELLHEPEVVNK
Ga0207964_112507723300026086MarineMIKCNYCPKGFVENMNGLAEKTFHEILHEPEIVNQ
Ga0208131_100461243300026213MarineYMIQCEYCDKNFIESMNGLAEKTFHEMLHAPEIVNQ
Ga0208522_114153623300026254MarineMIECTYCKRGFVESMNGLAEKTFHELLHEPKTVNN
Ga0228620_108836823300026483SeawaterVLYYMIQCEYCARGFIETSNGLAEKTFHELLHEPEVVNK
Ga0208950_101147033300027413MarineQYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK
Ga0209709_1000481413300027779MarineYGTILYYMIQCEYCPRGFIETTNGLAEKTFHELLHEPEVVNK
(restricted) Ga0233416_10001237103300027799SedimentMITCEYCPERFIESMNGLVEKTFHELLHEPEMVNK
(restricted) Ga0255041_1035613323300027837SeawaterMIQCEYCPKGFIETANGLAEKTFHELLHEPRVVNK
Ga0209089_1009257513300027838MarineMIQCEYCPRGFIDTTTGLAEKTFHELLHEPEVVNK
(restricted) Ga0255053_1043757623300027868SeawaterMIVCEYCPEKFIENMNGLVEKTFHELLHEPKMVNE
(restricted) Ga0255058_1012720123300027872SeawaterMIACEYCPEKFIENMNGLVEKTFHELLHAPEMVNE
(restricted) Ga0255058_1019247613300027872SeawaterYRNLMITCEYCKERFVENMNGLAEKTFHELLHDPKMVNN
Ga0209857_100464023300027957Groundwater SandMIVCEYCPERFIENMNGLVEKTFHELLHEPEMVNK
Ga0257119_106527823300028274MarineYMIQCEFCTRGFIETANGLAEKTFHELLHEPTIVNK
Ga0257111_125744613300028535MarineMIKCNYCTKGFIESMNGLAEKTFHEILHKPEIVNQ
Ga0265306_1008569813300028598SedimentMIQCEYCPRGFVDTANGLVAKTFHELLHEPEVVNK
Ga0265309_1000621113300028599SedimentTIPYYMIQCEYCPRGFIETVNGLAEKTFHELLHEPEVVNK
Ga0265303_1002821213300028600SedimentYGTIPYYMIQCEYCPRGFIETVNGLAEKTFHELLHEPEVVNK
Ga0265303_1151872013300028600SedimentTIPYCMIQCEYCPRGFVDTANGLVAKTFHELLHEPEVVNK
Ga0247727_10001158363300031576BiofilmMVPYHMIHCEYCPRQFVESRSGLTEKTLHEILHGPELVNE
Ga0247727_1002032993300031576BiofilmMITCDYCPEKFVENMNGLVVKTFHELLHEPEMVNK
Ga0247727_1004815933300031576BiofilmMITCEYCPEKFVESMNGLVVKTFHELLHEPEMVNK
Ga0307994_111713413300031660MarineQYYMIQCEYCPRGFIETTTGLAEKTFHELLHEPEVVNK
Ga0315328_1022991223300031757SeawaterYMLECEYCEQHFIETRNGLVEKTFHELLHDPETVNK
Ga0315322_1022128113300031766SeawaterIQYYMLECEYCEQHFIETRNGLAEKTFHELLHDPETVNK
Ga0315332_1057432823300031773SeawaterMLECEYCEQYFIENRNGLAEKTFHELLHDPETVNK
Ga0310121_1001220123300031801MarineMIQCEYCSRGFVDTMNGLAEKTFHEVLHAPKIVNQ
Ga0315272_1069532513300032018SedimentIPYHMIQCEYCPRGFIDTANGLAEKTFHELLHEPEVVNK
Ga0315268_1030969813300032173SedimentGTIPYLMIQCEYCPRGFIDTANGLAEKTFHELLHEPEVVNK
Ga0316202_1015870723300032277Microbial MatMIQCEYCPRGFVDTANGLVAKTFHELLHEPDVVNK
Ga0310345_1020912433300032278SeawaterMIQCEYCDKNFIESMNGLAEKTFHEMLHTPEIVNQ
Ga0334722_10000888243300033233SedimentMIVCEYCPEKFVENMNGLVEKTFHELLHEPEMVNK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.