 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300001133 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0053054 | Gp0054773 | Ga0001351 |
| Sample Name | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 12770070 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1 |
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 1 |
| All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium CSP1-5 | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Soil Microbial Communities From Rifle, Colorado, Usa |
| Type | Environmental |
| Taxonomy | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Rifle, Colorado, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → land → soil |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Rifle, Colorado, USA | |||||||
| Coordinates | Lat. (o) | 39.53 | Long. (o) | -107.78 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F025141 | Metagenome / Metatranscriptome | 203 | Y |
| F067325 | Metagenome | 125 | N |
| F100776 | Metagenome | 102 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| C687J13250_100354 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota | 1871 | Open in IMG/M |
| C687J13250_103082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella mallensis | 578 | Open in IMG/M |
| C687J13250_103415 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → candidate division NC10 → unclassified candidate division NC10 → candidate division NC10 bacterium CSP1-5 | 552 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| C687J13250_100354 | C687J13250_1003542 | F025141 | MIVCEYCPEKFVENMNGLVEKTFHELLHEPEMVNK* |
| C687J13250_103082 | C687J13250_1030821 | F100776 | GLQEITGDLVSLTKQTIEHGIPQTFADPSVLNFEGYRQLEATPGSIYPATPKSGKSMQDAFYEIKTATLSAEVLPFFQQIQTLAQLVSGALPSLFGGQMDGSKTASEYSMSRAQALQRLQTTWKTFTIWWKQIFGKVIPAYIKDIVEDERLVEQDEQGNFVNTFIRMAELQGKIGSIELEANENLPMTWTQQ |
| C687J13250_103415 | C687J13250_1034152 | F067325 | MEGRASPEGSREEVEFFLFIGSDYGTADVHSLRKESFALIDYFAGFLGPPASGPQPINIGELMDSEDEIPVNAFWRIREDHRAEIVAGLLKALEDQEKRDG* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |