Scaffold Ga0137459_1000389

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0137459_1000389

Scaffold Ga0137459_1000389

Overview

Basic Information
Taxon OID	3300012228 Open in IMG/M
Scaffold ID	Ga0137459_1000389 Open in IMG/M
Source Dataset Name	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT700_2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	15686
Total Scaffold Genes	22 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (40.91%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location Name	USA: East River, Colorado
Coordinates	Lat. (^o)	38.9775	Long. (^o)	-107.0029	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103731	Metagenome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137459_100038913	F103731	N/A	MSTRGIRIAFVLAVVMVGVLPKRVECSYPGATCGHAGPWRTTCTSFEIFEIEPLGFYLIELAARRDIGFAYSGGDDCR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.