Scaffold Ga0118275_102796

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0118275_102796

Scaffold Ga0118275_102796

Overview

Basic Information
Taxon OID	3300012327 Open in IMG/M
Scaffold ID	Ga0118275_102796 Open in IMG/M
Source Dataset Name	Human skin bacterial and viral communities - University of Pennsylvania - MG100562
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Pennsylvania
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	693
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083289	Metagenome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0118275_1027961	F083289	N/A	EEGDTAYAESVCATEELKFYKDNVDPTDMTSLKKPTTEHEPAMKFKSADETKLVDFVPGDSSQQFSISANLDPK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.