Basic Information | |
---|---|
Taxon OID | 3300012327 Open in IMG/M |
Scaffold ID | Ga0118275_104003 Open in IMG/M |
Source Dataset Name | Human skin bacterial and viral communities - University of Pennsylvania - MG100562 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Pennsylvania |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 613 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae → Triticinae → Triticum → Triticum aestivum | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Human → Skin → Unclassified → Unclassified → Human Skin → Human Skin Bacterial And Viral Communities - University Of Pennsylvania |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F081962 | Metagenome | 113 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0118275_1040031 | F081962 | N/A | VVALSNEVPTHLAEVLRRLAVLPQRIQELRRASARAGAIAALSRAKAFLPELDPADIALGYPSLKEDGSAFDQKDFAACVKAVRPVATLIGNDTDLTKYQPGYDVENQRIPTPRYEAISLVPPTRKHTFAPEIDPAGLIDEEAQFEALSGIDWKSSTFQVLGTAGGAERDEPEASTQQAS |
⦗Top⦘ |