Basic Information | |
---|---|
Taxon OID | 3300012662 Open in IMG/M |
Scaffold ID | Ga0116619_1035703 Open in IMG/M |
Source Dataset Name | Baboon gut microbial communities from fecal samples in Kenya - F10 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Duke University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 811 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → unclassified Prevotella → Prevotella sp. | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Baboon Gut → Baboon Gut Microbial Communities From Fecal Samples In Kenya |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | 2.717 | Long. (o) | 37.1 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F036964 | Metagenome / Metatranscriptome | 169 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0116619_10357032 | F036964 | AGGAG | MELLRIIFPIMMVIGALGSLVVNIIQKGDWPTSLQWLGAMLLYTALTFRNVRG* |
⦗Top⦘ |