Scaffold Ga0116619_1035703

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0116619_1035703

Scaffold Ga0116619_1035703

Overview

Basic Information
Taxon OID	3300012662 Open in IMG/M
Scaffold ID	Ga0116619_1035703 Open in IMG/M
Source Dataset Name	Baboon gut microbial communities from fecal samples in Kenya - F10
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Duke University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	811
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Prevotellaceae → Prevotella → unclassified Prevotella → Prevotella sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Baboon Gut → Baboon Gut Microbial Communities From Fecal Samples In Kenya

Source Dataset Sampling Location
Location Name
Coordinates	Lat. (^o)	2.717	Long. (^o)	37.1	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036964	Metagenome / Metatranscriptome	169	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0116619_10357032	F036964	AGGAG	MELLRIIFPIMMVIGALGSLVVNIIQKGDWPTSLQWLGAMLLYTALTFRNVRG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.