Scaffold Ga0164241_11203973

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0164241_11203973

Scaffold Ga0164241_11203973

Overview

Basic Information
Taxon OID	3300012943 Open in IMG/M
Scaffold ID	Ga0164241_11203973 Open in IMG/M
Source Dataset Name	Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	560
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Source Dataset Sampling Location
Location Name	USA: Emeryville, California
Coordinates	Lat. (^o)	37.83	Long. (^o)	-122.29	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085354	Metagenome	111	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0164241_112039731	F085354	GGAG	MAKRAAAAESKPAVNAPDESFVELMLVAADFVKCCGGLEPAKKSLDDAGQFITKAGGVSKASKALSVLENLKERIG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.