Scaffold Ga0164299_11326313

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0164299_11326313

Scaffold Ga0164299_11326313

Overview

Basic Information
Taxon OID	3300012958 Open in IMG/M
Scaffold ID	Ga0164299_11326313 Open in IMG/M
Source Dataset Name	Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	552
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Amended Soil Microbial Communities From New York, Usa To Study Carbon Cycling

Source Dataset Sampling Location
Location Name	USA: Mt. Pleasant research farm, Cornell University, New York
Coordinates	Lat. (^o)	42.4531	Long. (^o)	-76.3842	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050552	Metagenome / Metatranscriptome	145	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0164299_113263131	F050552	N/A	VACYTRASGLRGVVVCPPLAFLAGSVLAQLITAADAFAAATGILVTLGTSAPWLFTGTGLTMAIALGRGWRPELVTGMVAHLRQALRDIRPRGDRWVERR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.