Basic Information | |
---|---|
Taxon OID | 3300012978 Open in IMG/M |
Scaffold ID | Ga0157393_12862 Open in IMG/M |
Source Dataset Name | Hot spring water viral communities from Western Cape, South Africa - Brandvlei |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of the Western Cape |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2033 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Hot Spring Water → Hot Spring Water Viral Communities From Western Cape, South Africa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Western Cape, South Africa | |||||||
Coordinates | Lat. (o) | -33.732496 | Long. (o) | 19.413317 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F093488 | Metagenome / Metatranscriptome | 106 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0157393_128622 | F093488 | AGGAGG | MADGLFYWDTREPFIGADIASVTLSTTDVALYPPSNFPVLGGQYWSRVGKKIRIRLFGRMTTGATPGNLTFDIYYGSGANATGTILASSAAVALTASQTNLSWMCEVTVHCRSIGSSGTLFCVGWALFNPSLIASTNQPILIPASAPVVSAAVDLTAANIISIQAKRSGSTTETMQVHDMEVVAMN* |
⦗Top⦘ |