Scaffold Ga0164286_135099

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0164286_135099

Scaffold Ga0164286_135099

Overview

Basic Information
Taxon OID	3300013049 Open in IMG/M
Scaffold ID	Ga0164286_135099 Open in IMG/M
Source Dataset Name	Enriched Organic Plus compost microbial communities from Emeryville, California, USA - RNA 5th pass 30_C BE-Lig OP (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	598
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Haptista → Haptophyta → Prymnesiophyceae → Coccolithales → Coccolithaceae → Coccolithus → Coccolithus braarudii	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Lignin-Adapted Enriched Soil Microbial Communities From Emeryville, California, Usa

Source Dataset Sampling Location
Location Name	USA: Emeryville, California
Coordinates	Lat. (^o)	37.83	Long. (^o)	-122.29	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F006133	Metagenome / Metatranscriptome	380	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0164286_1350991	F006133	AGCAG	MKASALLSLRALLALFALCVLAAPLLSALSATPERKAQDVEDCVACRYVWLQVEMDVGNSQIEENIYDSFTQNCIEAQKAPIFYPACQDMFDGIDDMIGDYMDGYTVNQVCENARLCR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.