NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116834_1000324

Scaffold Ga0116834_1000324


Overview

Basic Information
Taxon OID3300013188 Open in IMG/M
Scaffold IDGa0116834_1000324 Open in IMG/M
Source Dataset NameMarine hypoxic microbial communities from the Gulf of Mexico, USA - 6m_Station1_GOM_Metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterGeorgia Institute of Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6958
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (43.75%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Hypoxic Microbial Communities From The Gulf Of Mexico, Usa

Source Dataset Sampling Location
Location NameUSA: Gulf of Mexico
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F071302Metagenome / Metatranscriptome122Y

Sequences

Protein IDFamilyRBSSequence
Ga0116834_10003246F071302GGAMDILLFFTGISAIVYMSYKLGKDRGTMLASERAVDMMIAMGYLKERADGEIEKVDNEKSN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.