NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0177923_1143917

Scaffold Ga0177923_1143917


Overview

Basic Information
Taxon OID3300013414 Open in IMG/M
Scaffold IDGa0177923_1143917 Open in IMG/M
Source Dataset NameRat cecal microbial community from a salt sensitive rat, Toledo, Ohio, USA - rat 1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of California, Davis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)696
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Cecum → Rat Cecum → Rat Cecal Microbial Communities From Salt Sensitive Rats, Toledo, Ohio, Usa

Source Dataset Sampling Location
Location NameToledo, Ohio, USA
CoordinatesLat. (o)41.6639Long. (o)-83.5552Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F077438Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0177923_11439171F077438N/ASLCCVYSTHRVERPFAQRRFETLFLWSLKVEISSDLMPTVEKEISSNKN*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.