Basic Information | |
---|---|
Taxon OID | 3300013414 Open in IMG/M |
Scaffold ID | Ga0177923_1143917 Open in IMG/M |
Source Dataset Name | Rat cecal microbial community from a salt sensitive rat, Toledo, Ohio, USA - rat 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of California, Davis |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 696 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Cecum → Rat Cecum → Rat Cecal Microbial Communities From Salt Sensitive Rats, Toledo, Ohio, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Toledo, Ohio, USA | |||||||
Coordinates | Lat. (o) | 41.6639 | Long. (o) | -83.5552 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F077438 | Metagenome / Metatranscriptome | 117 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0177923_11439171 | F077438 | N/A | SLCCVYSTHRVERPFAQRRFETLFLWSLKVEISSDLMPTVEKEISSNKN* |
⦗Top⦘ |