Scaffold Ga0134492_1000487

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134492_1000487

Scaffold Ga0134492_1000487

Overview

Basic Information
Taxon OID	3300014824 Open in IMG/M
Scaffold ID	Ga0134492_1000487 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from ulcerative colitis therapy, University of Washington - UWIBD01P279T2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Washington
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	58387
Total Scaffold Genes	57 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	44 (77.19%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Commmunities From Fecal Microbiota Transplantation (Fmt) For Ulcerative Colitis - University Of Washington

Source Dataset Sampling Location
Location Name	USA: University of Washington
Coordinates	Lat. (^o)		Long. (^o)		Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F026489	Metagenome	197	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0134492_100048736	F026489	GGAGG	LVAKENQKTTSDFDALEPRKRGCSPLLTPKKWAAPKKTEDSRLFGVKIF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.