 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300014831 Open in IMG/M |
| Scaffold ID | Ga0167340_1020009 Open in IMG/M |
| Source Dataset Name | Raw sludge microbial communities from sewage treatment plant in Sweden - SWESTP63 - Kappala-primary 226 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | University of Gothenburg |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2543 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Paludibacteraceae → Paludibacter → Paludibacter propionicigenes | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Raw Primary Sludge → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Sweden | |||||||
| Coordinates | Lat. (o) | 59.355554 | Long. (o) | 18.227079 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F096161 | Metagenome | 105 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0167340_10200091 | F096161 | N/A | SWRKKLSCLSDKGASLDGFSQLSASFSSEAGAVLTFLFTFCVKTKSKSGLGAEAPVK* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |