Scaffold Ga0167340_1053372

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0167340_1053372

Scaffold Ga0167340_1053372

Overview

Basic Information
Taxon OID	3300014831 Open in IMG/M
Scaffold ID	Ga0167340_1053372 Open in IMG/M
Source Dataset Name	Raw sludge microbial communities from sewage treatment plant in Sweden - SWESTP63 - Kappala-primary 226
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Gothenburg
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1284
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Raw Primary Sludge → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location
Location Name	Sweden
Coordinates	Lat. (^o)	59.355554	Long. (^o)	18.227079	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F010914	Metagenome / Metatranscriptome	297	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0167340_10533722	F010914	AGG	MIYKILVEQNGKFVATGETIECEFEETQAVIDELQLEHGCCCALEAVNE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.