Basic Information | |
---|---|
Taxon OID | 3300014831 Open in IMG/M |
Scaffold ID | Ga0167340_1147012 Open in IMG/M |
Source Dataset Name | Raw sludge microbial communities from sewage treatment plant in Sweden - SWESTP63 - Kappala-primary 226 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Gothenburg |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 655 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Raw Primary Sludge → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Sweden | |||||||
Coordinates | Lat. (o) | 59.355554 | Long. (o) | 18.227079 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F095356 | Metagenome | 105 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0167340_11470121 | F095356 | N/A | VSVGDDAMITAPVAKALLEHDPKLIPVILGCLNHFEIAIDDKQIAPQRMTTPPQARQFKTLGAAYSYLRNFLDYRGDVSIRLSDPTTGTGDIL* |
⦗Top⦘ |