NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0167340_1168181

Scaffold Ga0167340_1168181


Overview

Basic Information
Taxon OID3300014831 Open in IMG/M
Scaffold IDGa0167340_1168181 Open in IMG/M
Source Dataset NameRaw sludge microbial communities from sewage treatment plant in Sweden - SWESTP63 - Kappala-primary 226
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Gothenburg
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)602
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Industrial Wastewater → Unclassified → Unclassified → Raw Primary Sludge → Sewage Microbial Communities From Wastewater Treatment Plant In Sweden

Source Dataset Sampling Location
Location NameSweden
CoordinatesLat. (o)59.355554Long. (o)18.227079Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067845Metagenome125N

Sequences

Protein IDFamilyRBSSequence
Ga0167340_11681811F067845N/ALLAGVLALGVLTACSGLGGVNTGTDAEKAAELAQQLGVAHTQELDNTAKAVAEWFVQEPDSLRVSGLDLVYTVALDADSNMGYTGDLNKFLYWSGCYGVPEDVTVALLLDDSTAMTAQLYAPQADSAAVELLDDAADHSELGAAFIDYNGTAYVVAVFR*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.