Scaffold Ga0169813_100813

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0169813_100813

Scaffold Ga0169813_100813

Overview

Basic Information
Taxon OID	3300014947 Open in IMG/M
Scaffold ID	Ga0169813_100813 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from infant at 12 months in Denmark - 589_12M
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Genomics Institute (BGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	32337
Total Scaffold Genes	34 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	27 (79.41%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Source Dataset Sampling Location
Location Name	Denmark
Coordinates	Lat. (^o)	55.678	Long. (^o)	12.531	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F090514	Metagenome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0169813_10081331	F090514	N/A	MNLRIHALKKASRQRPGVKIAAARFFSILYYPFCAKRSSFFQQNVQPRGNFFANRPIFVYFADILPRLTGAKWFVILLTIVPAGSRTRAGSSLPLSPASIFF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.