NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0187309_10501

Scaffold Ga0187309_10501


Overview

Basic Information
Taxon OID3300017461 Open in IMG/M
Scaffold IDGa0187309_10501 Open in IMG/M
Source Dataset NameHotspring sediment microbial communities from Obsidian Pool, Yellowstone National Park, Wyoming, USA ? Obsidian 5. Combined Assembly of Gp0212721, Gp0212722
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterStanford University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16245
Total Scaffold Genes24 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (45.83%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hotspring Sediment → Yellowstone National Park Obsidian Pool Microbial Communities

Source Dataset Sampling Location
Location NameYNP, Wyoming, USA
CoordinatesLat. (o)44.428Long. (o)-110.5885Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F068875Metagenome / Metatranscriptome124N
F081384Metagenome / Metatranscriptome114N

Sequences

Protein IDFamilyRBSSequence
Ga0187309_1050118F081384AGGMLITPSDFGGDYRLFNANNLDPDTIQAIDQAQAELARDLFPVGHSFITGNLPSAPPNLGLRVLGLHNLFVPWVFLRLELGILGAGVKRASDVPGRSRFASGAFFAIARQYRYFLGEWLPYEGYIDAVATSPTLLSVPIVASQIVAPGMEIEIGGAKYSVVASATGLLTISPALPSGVTNLRFRQLSLRVDKKWNYL
Ga0187309_1050122F068875N/AMALQCRCGQPIEAFGVPSCYTKMAPIVRLIFTTRPNQLITDPATQLELSPTNTSFPDIYRLITPRLDDVSSERPEAVTEEIGATTYYVRDAARTITATVGQLPTEWAQRVAELRCQAEVGVFLVDANGTIWGRKVDTQTGVAGASLPVVPSSIDARFAFPSYSSVQKHTITFQLPFTLADYEIIPLWNDGGVLNYSAPQPVGFRVFQESGNWVVFLFSKYHAPNGTIVVPIANVANPADIDIFDDSGTTLVASANANLGGGKYALNNPLTAGTQYILDCTAITSPPRTQFDWPALRVPFR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.