Basic Information | |
---|---|
Taxon OID | 3300017482 Open in IMG/M |
Scaffold ID | Ga0186907_15496 Open in IMG/M |
Source Dataset Name | Hotspring sediment microbial communities from Obsidian Pool, Yellowstone National Park, Wyoming, USA ? Obsidian 2. Combined Assembly of Gp0212715, Gp0212716 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Stanford University |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 5205 |
Total Scaffold Genes | 9 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Sediment → Yellowstone National Park Obsidian Pool Microbial Communities |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | YNP, Wyoming, USA | |||||||
Coordinates | Lat. (o) | 44.428 | Long. (o) | -110.5885 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F104050 | Metagenome | 101 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0186907_154964 | F104050 | GGA | MSEVKKCIIRLRKYCVVYESLSSEEREKYGSKEFVITYCGLCIKSVYAKAKRKLVNKFSVVNTL |
⦗Top⦘ |