NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186907_15756

Scaffold Ga0186907_15756


Overview

Basic Information
Taxon OID3300017482 Open in IMG/M
Scaffold IDGa0186907_15756 Open in IMG/M
Source Dataset NameHotspring sediment microbial communities from Obsidian Pool, Yellowstone National Park, Wyoming, USA ? Obsidian 2. Combined Assembly of Gp0212715, Gp0212716
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterStanford University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)16995
Total Scaffold Genes32 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (43.75%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Hyperthermophilic Archaeal Virus 1(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Sediment → Yellowstone National Park Obsidian Pool Microbial Communities

Source Dataset Sampling Location
Location NameYNP, Wyoming, USA
CoordinatesLat. (o)44.428Long. (o)-110.5885Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000750Metagenome / Metatranscriptome908Y

Sequences

Protein IDFamilyRBSSequence
Ga0186907_1575631F000750GGAMIASIVVTAVLFSYWLYKKLAKPKTFQFPIDVQTGDVIHSAFGSLLANLSMQGHLFDVAVGVVLYLAYQIFDWTVKKDTIYKDVATFTAGYFITLTAEYIPV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.