Scaffold Ga0186926_11546

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0186926_11546

Scaffold Ga0186926_11546

Overview

Basic Information
Taxon OID	3300017562 Open in IMG/M
Scaffold ID	Ga0186926_11546 Open in IMG/M
Source Dataset Name	Hotspring sediment microbial communities from Obsidian Pool, Yellowstone National Park, Wyoming, USA ? Obsidian 3. Combined Assembly of Gp0212718, Gp0212717
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Stanford University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	9084
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (62.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Aquificae → Aquificae → Aquificales → Hydrogenothermaceae → Sulfurihydrogenibium → Sulfurihydrogenibium yellowstonense	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Sediment → Yellowstone National Park Obsidian Pool Microbial Communities

Source Dataset Sampling Location
Location Name	YNP, Wyoming, USA
Coordinates	Lat. (^o)	44.428	Long. (^o)	-110.5885	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F043237	Metagenome / Metatranscriptome	156	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0186926_115462	F043237	GGAGG	MELRRTARYIAQLSGHGYKYAVVGKLARYDKKLVKRLEYEGFVFYLCRFQTKKEVVEYCLERAEGTFRVYCLASKPLEFPNAPLKLWYDEKNQRLKLLARRSFINECLRVIERASSLKYPNHKLYTAKVNEALRNLYSILAYTYNDKERIQAIKRKVKHLFVEALKENYGIEPKKAMEDYRRFVLKFSDVLKRKQRTNSSTS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.