NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0186926_15636

Scaffold Ga0186926_15636


Overview

Basic Information
Taxon OID3300017562 Open in IMG/M
Scaffold IDGa0186926_15636 Open in IMG/M
Source Dataset NameHotspring sediment microbial communities from Obsidian Pool, Yellowstone National Park, Wyoming, USA ? Obsidian 3. Combined Assembly of Gp0212718, Gp0212717
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterStanford University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5494
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Sediment → Yellowstone National Park Obsidian Pool Microbial Communities

Source Dataset Sampling Location
Location NameYNP, Wyoming, USA
CoordinatesLat. (o)44.428Long. (o)-110.5885Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F043237Metagenome / Metatranscriptome156Y

Sequences

Protein IDFamilyRBSSequence
Ga0186926_156361F043237GGAGGMELRRTARYIAQLSGHGYKYAVVGKLARYDKKLVKRLEYEGFVFYLCRFQTKKEVVEYCLERAEGTFRVYCLASKPLEFPNAPLKLWYDEKNQRLKLLARRSFINECLRVIERASSLKYPNHKLYTAKVNEALRNLYSILAYTYNDKERIRAIKRKVKHLFVEALKENYGIEPKKAMEDYRRFVLKFSDVLKRKQRTNSSTS

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.