Scaffold Ga0182238_1003485

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0182238_1003485

Scaffold Ga0182238_1003485

Overview

Basic Information
Taxon OID	3300017922 Open in IMG/M
Scaffold ID	Ga0182238_1003485 Open in IMG/M
Source Dataset Name	Subsurface microbial communities from deep shales in Texas, USA - hydraulic fracturing test 6_PW_90
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3487
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (80.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Crenarchaeota → Thermoprotei → Desulfurococcales → Desulfurococcaceae → unclassified Desulfurococcaceae → Desulfurococcaceae archaeon	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location Name	USA: Texas
Coordinates	Lat. (^o)	30.238	Long. (^o)	-102.628	Alt. (m)		Depth (m)	2000
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F027047	Metagenome	196	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0182238_10034853	F027047	AGGA	MEVGSLIIAVFSAVVYALSMYVKKHLNKENPQDFDVAKFTTTVIWGAIIGVVLQYSGVGITEQTVEQQFITYTGLIAITENIVRAIIRSIRRRRSWSTTILAI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.