NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0184604_10000228

Scaffold Ga0184604_10000228


Overview

Basic Information
Taxon OID3300018000 Open in IMG/M
Scaffold IDGa0184604_10000228 Open in IMG/M
Source Dataset NameGroundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5240
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment → Soil And Sediment Microbial Communities From The East River, Co, Usa

Source Dataset Sampling Location
Location NameUSA: East River, Colorado
CoordinatesLat. (o)38.9195Long. (o)-106.9496Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064925Metagenome / Metatranscriptome128Y
F089941Metagenome / Metatranscriptome108Y
F093175Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0184604_100002282F064925GGAGMMGEELARCHAGAMLRARPGHYYCARCLARLLGSAAVWTKGDARWAIAVLFRWPIGLTAILRYGPDPCGHCGVVGGALLGSV
Ga0184604_100002283F089941N/AMTAVTYTTEDFVRRTIGRLLRGKYRGGGLCSWCLVGMTLERLHTGWRKSEIEHAMEKVFNAPGALGSTPSGPCSRCKRPNPCIGERPA
Ga0184604_100002285F093175GAGGMDGLRQIQVVTQGDGWHLVGLDAEGRVWFGSPRRTTKGRMLAWILMDESVEVEDPSPPTSIVTSESLEPGVADRHWPVKPRS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.