Scaffold Ga0193577_107995

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0193577_107995

Scaffold Ga0193577_107995

Overview

Basic Information
Taxon OID	3300018624 Open in IMG/M
Scaffold ID	Ga0193577_107995 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine microbial communities from deep sea water colum in Eastern Mediterranean Sea - KM3-5
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Woods Hole Oceanographic Institution
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	737
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Metatranscriptome Of Marine Microbial Communities From Deep Sea Water Colum In Eastern Mediterranean Sea

Source Dataset Sampling Location
Location Name	Eastern Mediterranean Sea
Coordinates	Lat. (^o)	36.29	Long. (^o)	15.39	Alt. (m)		Depth (m)	2200
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077438	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193577_1079951	F077438	N/A	VERPFTQSRFETLFLWNLQVEISSDLMPTVEKEIS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.