Scaffold Ga0192840_1040402

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0192840_1040402

Scaffold Ga0192840_1040402

Overview

Basic Information
Taxon OID	3300018686 Open in IMG/M
Scaffold ID	Ga0192840_1040402 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_052 - TARA_N000000593 (ERX1789430-ERR1719415)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Canada's Michael Smith Genome Sciences Centre
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	580
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Malvales → Malvaceae → Sterculioideae → Pterygota	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	Indian Ocean: TARA_052
Coordinates	Lat. (^o)	-16.953	Long. (^o)	53.9825	Alt. (m)		Depth (m)	70
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089810	Metatranscriptome	108	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0192840_10404022	F089810	AGGA	MACQVTLRLAFLLLLVFALQSQALYLSNDGSPVHGLAKRRPEMGAQGFTGDSFNGGFGDFYTMKRAGGRSSIDAKLDYIIQQLAAEKA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.