Scaffold Ga0193542_10021852

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0193542_10021852

Scaffold Ga0193542_10021852

Overview

Basic Information
Taxon OID	3300018938 Open in IMG/M
Scaffold ID	Ga0193542_10021852 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_039 - TARA_B100000091 (ERX1399742-ERR1328124)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Canada's Michael Smith Genome Sciences Centre
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	664
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	Indian Ocean: TARA_039
Coordinates	Lat. (^o)	18.5839	Long. (^o)	66.4727	Alt. (m)		Depth (m)	25
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048369	Metagenome / Metatranscriptome	148	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0193542_100218522	F048369	GAG	MKEDRDSFIEKLADNTPHEGQFDKLKEAEVHDAEEDLVAGKTFKKLKDEVKRGEK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.