NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0173481_10000450

Scaffold Ga0173481_10000450


Overview

Basic Information
Taxon OID3300019356 Open in IMG/M
Scaffold IDGa0173481_10000450 Open in IMG/M
Source Dataset NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8771
Total Scaffold Genes17 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (88.24%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F064703Metagenome / Metatranscriptome128Y
F066928Metagenome / Metatranscriptome126Y
F073765Metagenome / Metatranscriptome120N
F095448Metagenome / Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
Ga0173481_1000045011F073765GGAMRQLIGKIPIKGQKLMEEVYLSEQIRCLECQKTVPIGVEVVRVQKEGQAKKVLKRVFYCRSHAGDYESRARGEG
Ga0173481_1000045016F066928AGGMSPADRYRALAAYLRTCAAREQRPEVRTQWTKLAQCYLRLAEQADQNSRADIVYEFDRSARRGDVGGGPA
Ga0173481_100004506F095448GGAGMMASTLTHQPDPAIPNIACPKCGLRMQVAAIEPAGDNDRTVTFGCDCGHRYDLSERAIVALARDSSDRW
Ga0173481_100004508F064703AGCAGGMRKSLTVLIVALLGVFAVKSIIGPGKMNLGESVKYPVPTYDLHVAQPVDMKNFPSDVIPL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.