NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0173481_10002864

Scaffold Ga0173481_10002864


Overview

Basic Information
Taxon OID3300019356 Open in IMG/M
Scaffold IDGa0173481_10002864 Open in IMG/M
Source Dataset NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4403
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location
Location NameUSA: Wisconsin
CoordinatesLat. (o)43.3Long. (o)-89.38Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F040398Metagenome / Metatranscriptome162Y
F071396Metagenome / Metatranscriptome122N
F077375Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0173481_100028642F071396GGAMNSALAQVVIPYGNFDDGFEKYLVAAITFLLLCFAVWQYLRDRK
Ga0173481_100028643F077375GGAGMVGKIARGAYVFVVGTMIVAWVISFNKEVPARPQTGPQVWYIYS
Ga0173481_100028646F040398N/ACVATSSKVLSERRDDLVKFVAAEMDAYRFALANRAETIKVSHEMTHAKPDDKRAEFITDEAIKNKQIDPVLSIPLDRLDWMQNLFVKAGVIKQTVPIESIVDKSVNADAAKIAGK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.