Scaffold Ga0197853_1043694

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0197853_1043694

Scaffold Ga0197853_1043694

Overview

Basic Information
Taxon OID	3300019775 Open in IMG/M
Scaffold ID	Ga0197853_1043694 Open in IMG/M
Source Dataset Name	Lab enriched sediment microbial communities from hydrocarbon-contaminated retail site, Toronto, Canada - S1, HI.1247_001
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Genome Quebec
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	120258
Total Scaffold Genes	125 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	81 (64.80%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enriched Sediment → Metagenomes From Benzene-Degrading Nitrate-Reducing Cultures

Source Dataset Sampling Location
Location Name	Toronto, ON, Canada
Coordinates	Lat. (^o)	43.6532	Long. (^o)	-79.3832	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025775	Metagenome	200	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0197853_1043694120	F025775	GGAG	MKQLFTFQGFPMVVVVALIVWSWISILSVLIAAFF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.