Scaffold Ga0182240_100332

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0182240_100332

Scaffold Ga0182240_100332

Overview

Basic Information
Taxon OID	3300020032 Open in IMG/M
Scaffold ID	Ga0182240_100332 Open in IMG/M
Source Dataset Name	Subsurface microbial communities from deep shales in Texas, USA - hydraulic fracturing test 4_PW_90
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	16572
Total Scaffold Genes	21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	20 (95.24%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location Name	USA: Texas
Coordinates	Lat. (^o)	30.238	Long. (^o)	-102.628	Alt. (m)		Depth (m)	2000
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F083468	Metagenome	112	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0182240_10033220	F083468	GAGG	MICDKSCEIYPCFVAVPGKECKLAEYPESVQEIVRSFYRGKESFEHELRNMAARIYVKALMDGEIDVMVKVLKELAFVYKILYSNAPDEDERAWERILEVLNDDEGKGDSD

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.