NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0182240_100362

Scaffold Ga0182240_100362


Overview

Basic Information
Taxon OID3300020032 Open in IMG/M
Scaffold IDGa0182240_100362 Open in IMG/M
Source Dataset NameSubsurface microbial communities from deep shales in Texas, USA - hydraulic fracturing test 4_PW_90
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15589
Total Scaffold Genes22 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)19 (86.36%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracking Water → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameUSA: Texas
CoordinatesLat. (o)30.238Long. (o)-102.628Alt. (m)Depth (m)2000
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F092975Metagenome106N

Sequences

Protein IDFamilyRBSSequence
Ga0182240_1003626F092975GGAGGVMVYDLPITVLMGKELTILTLYDGENEIHEVVDTTLDEEQLQKVVDKIIDEFEKRGYDWGYNELFEEMEKRGYIRVYASRKVVVNV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.