Scaffold Ga0197144_102606

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0197144_102606

Scaffold Ga0197144_102606

Overview

Basic Information
Taxon OID	3300020145 Open in IMG/M
Scaffold ID	Ga0197144_102606 Open in IMG/M
Source Dataset Name	Sediment microbial communities from Great Boiling Springs, Gerlach, Nevada, United States - GBS 85_MetaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3602
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	10 (90.91%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	USA: Nevada
Coordinates	Lat. (^o)	40.6614	Long. (^o)	-119.3661	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080678	Metagenome	115	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0197144_1026069	F080678	GGAGG	MFVKKVDVRTVPITQAYENWECIWLGEREIRRFLAYTGLTAPPYNLRVENFLKFPFLRGMTARRFVQKLRRLGVTWSWNNDAMRRSILLAIGYRLLEIEEFEHYRIFGRKEVSVNV

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.