Scaffold Ga0194035_1000043

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0194035_1000043

Scaffold Ga0194035_1000043

Overview

Basic Information
Taxon OID	3300020167 Open in IMG/M
Scaffold ID	Ga0194035_1000043 Open in IMG/M
Source Dataset Name	Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L239-20m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	77867
Total Scaffold Genes	85 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	73 (85.88%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater → Anoxic Zone Freshwater Microbial Communities From Boreal Shield Lakes In Iisd Experimental Lakes Area, Ontario, Canada

Source Dataset Sampling Location
Location Name	Canada: Ontario
Coordinates	Lat. (^o)	49.663	Long. (^o)	-93.723	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088668	Metagenome / Metatranscriptome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0194035_10000435	F088668	AGGAGG	METKVIKWDGSHVPEELRGLPPGRYAIESVDQVGVLTEEEEAGLLAGLTELDAGGGIPLADVVREIIRGGTAKR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.