Scaffold Ga0211579_10629861

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0211579_10629861

Scaffold Ga0211579_10629861

Overview

Basic Information
Taxon OID	3300020472 Open in IMG/M
Scaffold ID	Ga0211579_10629861 Open in IMG/M
Source Dataset Name	Marine microbial communities from Tara Oceans - TARA_B100001250 (ERX556017-ERR598995)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	CEA Genoscope
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	600
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From Tara Oceans

Source Dataset Sampling Location
Location Name	TARA_132
Coordinates	Lat. (^o)	31.4813	Long. (^o)	-159.088	Alt. (m)		Depth (m)	115
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089403	Metagenome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0211579_106298612	F089403	GAGG	MADPYPAIGSNYRPNIEPSTTNRGLTLTAEEVVALRDLLSHIPDPSKEVVSLYDKVKLL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.