NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210404_10004878

Scaffold Ga0210404_10004878


Overview

Basic Information
Taxon OID3300021088 Open in IMG/M
Scaffold IDGa0210404_10004878 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5395
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)10 (76.92%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025584Metagenome / Metatranscriptome201Y
F034330Metagenome / Metatranscriptome175Y
F035065Metagenome / Metatranscriptome173Y
F037102Metagenome / Metatranscriptome168Y

Sequences

Protein IDFamilyRBSSequence
Ga0210404_1000487810F037102AGGAGGMNESGLEFTEQVLRPAVHEKILLRAAELVALGWTRGTAARDAEERKVRSTAPQATAWCVVGAVDRALYELWALDVYALLGLDVDAYDTAPCPSELLLALRRSFQRVLGRRDLAHWNDHGCPGPAAAEELLREAAARAARS
Ga0210404_1000487811F035065GGAGGMTDREVEAISDFLRHFGSFGCRQICVRRAEPKPRTPEDVGRFVLETLATWGAEGLDAGRLYKVATIAIHFEAYKLPGVICMPACCRPWGEVEPACPPGPGRPLTGAQLQQALLRAVPIGSLRGPDAPLPDDLDEDLKRTGLAP
Ga0210404_1000487812F025584GAGGVGDPRLDEPRRWGAFWIHHEAEELRVHHRTTIPAGDARALVVTLLASGRVPPLQATLFDSESADAGPGLERFWGTTCRCDAVVYLILFINERCLVLALSG
Ga0210404_100048787F034330GGAGGMRGVETLTLVLIATVLFMWVVLGHSTPDERARLQDSMGQSTGIAWR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.