NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0214166_1001475

Scaffold Ga0214166_1001475


Overview

Basic Information
Taxon OID3300021139 Open in IMG/M
Scaffold IDGa0214166_1001475 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Trout Bog Lake, WI - Practice 18AUG2009 epilimnion
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10140
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)18 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater → Freshwater Microbial Communities From Lake Mendota And Trout Bog Lake, Wisconsin, Usa

Source Dataset Sampling Location
Location NameTrout Bog, Vilas County, Wisconsin, USA
CoordinatesLat. (o)46.0412Long. (o)-89.6864Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009720Metagenome / Metatranscriptome314Y
F022104Metagenome216N
F083897Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
Ga0214166_100147513F009720GGAMLNPFKKKYIHEATGDVLTFSEQVSWKIQGIIRNWFFVILWTGVTFVWWAQPTWFTDTHAYIKWMNLASWLAVTVELIIGIAMIGQTKRDAMIIRHILKLEKQEIDHLQDIMEQQLHD
Ga0214166_100147514F022104AGGMTSTDLTTIAYNAVFTIGATGTGIWYIFKHGVQNVLKSEMNDIKTIKDEVTPNSGGSLNDAIRKQVIPMVETLVEKQQNIAVDLGTLNGKFEQHIREHNA
Ga0214166_10014757F083897GGAGMDDIANLKPTTGTEADYRNLGPIRVCPCGSDLWSVKCKFDDDGEIGIYFLDINCALCGSLAIAVTPPLGESHG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.