NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210408_10000011

Scaffold Ga0210408_10000011


Overview

Basic Information
Taxon OID3300021178 Open in IMG/M
Scaffold IDGa0210408_10000011 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)296970
Total Scaffold Genes295 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)231 (78.31%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019189Metagenome / Metatranscriptome231Y
F027575Metagenome / Metatranscriptome194Y
F038796Metagenome / Metatranscriptome165Y
F040778Metagenome / Metatranscriptome161N

Sequences

Protein IDFamilyRBSSequence
Ga0210408_10000011108F040778GGAGMSETVDIQVKPKPARDSSKDKRTLDQVEKWMETIREIGREPVKS
Ga0210408_10000011201F019189AGAAGGMKSLSTKLILSALGVALLATPAFAAKRHPASYQDLQNSAITAPSDVGTYPNGATKSGSAYSRESGAQDNLIR
Ga0210408_1000001146F038796GGAGMVDKITAQRDVEYITELLAKETDENRRVILQRLLADAEKLRQTTEDEDQEEISNKKTNADRVNSNDD
Ga0210408_1000001194F027575GAGMAALIAWMLVVRVDDLVKDGAKRRRLRRSSILDKIINANRVPSKRSRPLSKASHVL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.