Scaffold Ga0214510_1074296

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0214510_1074296

Scaffold Ga0214510_1074296

Overview

Basic Information
Taxon OID	3300021301 Open in IMG/M
Scaffold ID	Ga0214510_1074296 Open in IMG/M
Source Dataset Name	Enriched fungal communities from goat fecal pellet, Isla Vista, California, United States - Bagasse, Gen5, Rep 3, Penicillin and Streptomycin
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	629
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Methanomada group → Methanobacteria → Methanobacteriales → Methanobacteriaceae → Methanobrevibacter → unclassified Methanobrevibacter → Methanobrevibacter sp. YE315	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	34.4149	Long. (^o)	-119.841	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F086383	Metagenome / Metatranscriptome	110	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0214510_10742961	F086383	N/A	NHENFSNFDIVIWQTSILSSYAFHTNPEVKPSFIKTINKFVPNMDIIVVVQPLGDKNQIIQKFNDVIQQFDNVYPVNFVNGAIDLTFKETIETIFEVLPTCNWCGRLFTKTTHFKKYCSKNCKDYAKEEQNRLNFRSYYKRYKDTMSEAQKGALGSRGANLHAHANSDHEVEARLISNEKKRLGL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.