NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0213874_10009851

Scaffold Ga0213874_10009851


Overview

Basic Information
Taxon OID3300021377 Open in IMG/M
Scaffold IDGa0213874_10009851 Open in IMG/M
Source Dataset NameRoot-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2377
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots → Plant-Associated Microbial Communities From Velloziaceae Species In Rupestrian Grasslands, The National Park Of Serra Do Cipo, Brazil

Source Dataset Sampling Location
Location NameBrazil: Minas Gerais
CoordinatesLat. (o)-19.2822Long. (o)-43.5936Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F020613Metagenome223Y
F025602Metagenome / Metatranscriptome201Y
F089351Metagenome / Metatranscriptome109Y

Sequences

Protein IDFamilyRBSSequence
Ga0213874_100098512F089351GGAGMRARGWALLGSLVINLMLALVIVTVFSVSRPARAAESAQCPTHPAPTGRQSPAPPARSGQRYIVAVRMGWAMG
Ga0213874_100098514F025602AGGAGGVRPFSSECPKCGHERLLTGYVPEELLELLRAGAEIEGYCISCDEHWAIATDERADLARALGQSK
Ga0213874_100098517F020613N/AAACLRSSGMAEPFTLRERWFDVSALEFEAFLRDYPRPLDTRPPLSQKANYREWVDPSIGAWPGNAVGKSWKRGACLGYQIRLDLVLRVSAQERWNCAWCD

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.