NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0210394_10000399

Scaffold Ga0210394_10000399


Overview

Basic Information
Taxon OID3300021420 Open in IMG/M
Scaffold IDGa0210394_10000399 Open in IMG/M
Source Dataset NameForest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)94955
Total Scaffold Genes110 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)84 (76.36%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Forest Soil Microbial Communities From Barre Woods Harvard Forest Lter Site, Petersham, Massachusetts, United States

Source Dataset Sampling Location
Location NameUSA: Massachusetts
CoordinatesLat. (o)42.481016Long. (o)-72.178343Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000239Metagenome / Metatranscriptome1488Y
F001500Metagenome / Metatranscriptome682Y
F005283Metagenome / Metatranscriptome406Y
F092401Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0210394_1000039920F000239GGAGGMDQSKRRAVKFLEKEIKTYTALSLFLSKQGIRQHVRVGATTVLICPLFYRERMQEAQKLVSELKRPN
Ga0210394_1000039925F092401AGGAMPFSGNCHTFDSSTLKALNDDGSVYGLFKVDLPFRPDHYTCLFVGQTNDLRARLLEHYSHPSIAGVTHFFAEASATEEQRNPRERELIAEFNPPGNKTSEIANK
Ga0210394_1000039963F005283N/AMMQLTQPQMEVLQRLFEAGFRPIAIPPYEKALCVHRGELAALLAPVENGRLKLLAPVTVMVDGNLGVRLKKPSGDVFVWKKTEVPATPDKLNQLEKFRKELLAILEVGGG
Ga0210394_1000039999F001500GGAMANPNPLAGVAPRIVHPVNDGETTITEHIEKIEGEVALDTYVKTPTSAPEVVKRITELENCLQRLANAALSLSHDDRHPELRAAAEDAKLVLKNRLEVDDTKHRFHSELGTIKE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.