NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190362_1004284

Scaffold Ga0190362_1004284


Overview

Basic Information
Taxon OID3300021592 Open in IMG/M
Scaffold IDGa0190362_1004284 Open in IMG/M
Source Dataset NameHydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4872-18-5-6_MG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1690
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat → Microbial Communities From Sediments And Microbial Mats In Various Locations

Source Dataset Sampling Location
Location NameMexico: Guaymas Basin
CoordinatesLat. (o)27.0114Long. (o)-110.5956Alt. (m)Depth (m)2011
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F056227Metagenome137N
F059532Metagenome133N

Sequences

Protein IDFamilyRBSSequence
Ga0190362_10042841F056227N/AMEDKDTQVLVFHRDKDDKNWISRLANGKIAILHRADPTTPQPNVPYLCKVDEKEKYAIAWIQSLHAYPRAIITPPPRRFVYIGAPGEKPAIHTDILSIFDTHGLEYLYVKYPQENREEVKVPSTDYRDVDIDLRIKIGSESTIKYSC
Ga0190362_10042842F059532GAGMRNILLLGDLHCGSTEGLWHPDFVTREGQRIKLSPLQEELYEKWLLLRERLPDYEAVFLLGDITHGLGSKEFGKDVIDCDLHDQLQCAIKLLKPVTKGKKVVVITGSRYHSSIDYDIDRGLAEILHAKFGGAISNVRLKGTDVVINIAHGIGSRPVYTGTRMNQDVFNAILTEHLLKMPEVSVIIRAHFHIFSYFAIYGKHFIYIPGWNAIRKGRFVTRWYFRQPDIGAVLLSIDNDNNVYVKPSLFKLKSERKNICVL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.