NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194060_10130715

Scaffold Ga0194060_10130715


Overview

Basic Information
Taxon OID3300021602 Open in IMG/M
Scaffold IDGa0194060_10130715 Open in IMG/M
Source Dataset NameAnoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1352
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater → Anoxic Zone Freshwater Microbial Communities From Boreal Shield Lakes In Iisd Experimental Lakes Area, Ontario, Canada

Source Dataset Sampling Location
Location NameCanada: Ontario
CoordinatesLat. (o)49.697Long. (o)-93.722Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000473Metagenome / Metatranscriptome1097Y
F000671Metagenome / Metatranscriptome945Y
F073544Metagenome / Metatranscriptome120Y
F077310Metagenome / Metatranscriptome117Y

Sequences

Protein IDFamilyRBSSequence
Ga0194060_101307152F000473AGGMEFINKDKDHFKYGVNEWTGEPNKPVFYTPEMAKRIREIKKPDMSLQMDIARYPEFLAIRLYEDNFLQYEGIKKEMVIDYVGKVKKLIESYGVRCELEGVPSARILRSN
Ga0194060_101307153F073544AGGVREYYEVIKIVFIHAERLYGSVESLGLYASKVKYQKDGIEIEEVLENDEFTIMDEIVFEHVEESN
Ga0194060_101307154F000671GAGGMEKILCYSCNKTKNKLNVRKSILIPINLLMCETCISSKFEPRWVIILAGRQLGSDAVKEFIIKKRYCGNDIAASELLV
Ga0194060_101307155F077310N/AMTLDSNSILIVIIASILSGMGTALVSGIKEFKREKIRQAEREQDLLKMDLKDLEIKLYKLEKDLAEWRDKYYAAVQELIEVKSELENCLIELTHIVHHED
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.