Basic Information | |
---|---|
Taxon OID | 3300021854 Open in IMG/M |
Scaffold ID | Ga0187839_1116104 Open in IMG/M |
Source Dataset Name | Metatranscriptome of extremophilic microbial mat communities from Yellowstone National Park, Wyoming, USA - OCTB_RNA (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 538 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment → Extremophilic Microbial Mat Communities From Usa And Mexico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Wyoming | |||||||
Coordinates | Lat. (o) | 44.534 | Long. (o) | -110.7978 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F054065 | Metatranscriptome | 140 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0187839_11161041 | F054065 | N/A | TAYTRRLMAAFPLVSMAYRNLVVEAVDRWVRASGFDWTKERVSALVQWLLKLRAGENPSRPPWWSDRYLHYAERIATRAPFEKFLQLVQAWRTALTAYGGLKTVPSRKDVEKFERAVGTARVLTVPLPSGRVVEVDTEDWRARFPFRAYFGVSPRDVLPEVRIQRQILPNNPLSLKLTD |
⦗Top⦘ |