Scaffold Ga0212120_1011344

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0212120_1011344

Scaffold Ga0212120_1011344

Overview

Basic Information
Taxon OID	3300022544 Open in IMG/M
Scaffold ID	Ga0212120_1011344 Open in IMG/M
Source Dataset Name	Jinze_combined assembly
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2948
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Korarchaeota → Candidatus Korarchaeota archaeon	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	Baoshan, Yunnan, China
Coordinates	Lat. (^o)	25.4413	Long. (^o)	98.46	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103293	Metagenome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0212120_10113442	F103293	AGGAG	MELQALRELSRPYEIYEFVPCHPVDFKVMRYEVGRITIAPRWPGAPPQKTVIAVRLHVDPTTKPTFPYYWDITPSRLVHQLAAMLAADFKPGRTIRIHRDIPGPKAHFTVQWL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.