Basic Information | |
---|---|
Taxon OID | 3300022545 Open in IMG/M |
Scaffold ID | Ga0212125_1097629 Open in IMG/M |
Source Dataset Name | SSW_combined assebmly |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 523 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Methanomassiliicoccales → unclassified Methanomassiliicoccales → Methanomassiliicoccales archaeon | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Nevada, Gerlach, Sandy's Spring West | |||||||
Coordinates | Lat. (o) | 40.653 | Long. (o) | -119.3749 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F019254 | Metagenome | 231 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0212125_10976292 | F019254 | AGG | MPNERIHEALSHLRDEWPLRVLLSALAERVAELAALVGRASAQNLPPEFLTRIRAIEEEMRELSLLCQRPPAPEGRRKRKKVE |
⦗Top⦘ |